BLASTX nr result
ID: Panax25_contig00004339
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00004339 (496 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017257867.1 PREDICTED: transcription factor bHLH74 [Daucus ca... 58 6e-07 KZM92566.1 hypothetical protein DCAR_020069 [Daucus carota subsp... 58 6e-07 >XP_017257867.1 PREDICTED: transcription factor bHLH74 [Daucus carota subsp. sativus] Length = 401 Score = 58.2 bits (139), Expect = 6e-07 Identities = 29/48 (60%), Positives = 33/48 (68%), Gaps = 7/48 (14%) Frame = +2 Query: 371 MGTEDNGDMRFQHRDGDGTMN-------RNPLSEKVAEMGMSSGSIFK 493 MGTED+GDMRF HRDGDG +N NPLS+KVA M S S+FK Sbjct: 1 MGTEDHGDMRFHHRDGDGLLNVSSSVMSTNPLSDKVAGKAMGSASMFK 48 >KZM92566.1 hypothetical protein DCAR_020069 [Daucus carota subsp. sativus] Length = 427 Score = 58.2 bits (139), Expect = 6e-07 Identities = 29/48 (60%), Positives = 33/48 (68%), Gaps = 7/48 (14%) Frame = +2 Query: 371 MGTEDNGDMRFQHRDGDGTMN-------RNPLSEKVAEMGMSSGSIFK 493 MGTED+GDMRF HRDGDG +N NPLS+KVA M S S+FK Sbjct: 1 MGTEDHGDMRFHHRDGDGLLNVSSSVMSTNPLSDKVAGKAMGSASMFK 48