BLASTX nr result
ID: Panax25_contig00003976
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00003976 (570 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007017008.2 PREDICTED: uncharacterized protein LOC18591042 [T... 63 2e-09 EOY34627.1 6,7-dimethyl-8-ribityllumazine synthase [Theobroma ca... 60 3e-08 XP_011021006.1 PREDICTED: uncharacterized protein LOC105123193 [... 55 3e-06 XP_002319402.1 hypothetical protein POPTR_0013s14930g [Populus t... 55 3e-06 XP_015874727.1 PREDICTED: uncharacterized protein LOC107411627 [... 54 7e-06 XP_015870058.1 PREDICTED: uncharacterized protein LOC107407309 [... 54 7e-06 >XP_007017008.2 PREDICTED: uncharacterized protein LOC18591042 [Theobroma cacao] Length = 154 Score = 63.2 bits (152), Expect = 2e-09 Identities = 28/44 (63%), Positives = 33/44 (75%) Frame = -2 Query: 494 DVVPTEYCDSYLKHITSEKKPSRRDHRTARSGVWQPQLESIHED 363 DVV T+YCD YL ++ SEKK SRRD R+ R GVW+P L SI ED Sbjct: 111 DVVVTDYCDRYLSNVVSEKKSSRRDRRSGRVGVWRPHLASISED 154 >EOY34627.1 6,7-dimethyl-8-ribityllumazine synthase [Theobroma cacao] Length = 154 Score = 60.5 bits (145), Expect = 3e-08 Identities = 27/44 (61%), Positives = 32/44 (72%) Frame = -2 Query: 494 DVVPTEYCDSYLKHITSEKKPSRRDHRTARSGVWQPQLESIHED 363 DVV T+YCD YL ++ SEKK SR D R+ R GVW+P L SI ED Sbjct: 111 DVVVTDYCDRYLSNVVSEKKSSRGDRRSGRVGVWRPHLASISED 154 >XP_011021006.1 PREDICTED: uncharacterized protein LOC105123193 [Populus euphratica] Length = 156 Score = 55.1 bits (131), Expect = 3e-06 Identities = 25/37 (67%), Positives = 27/37 (72%) Frame = -2 Query: 473 CDSYLKHITSEKKPSRRDHRTARSGVWQPQLESIHED 363 CD YL I SEKK SRRD RT R GVW+P L+SI ED Sbjct: 120 CDRYLTDIVSEKKSSRRDRRTGRVGVWRPHLQSISED 156 >XP_002319402.1 hypothetical protein POPTR_0013s14930g [Populus trichocarpa] EEE95325.1 hypothetical protein POPTR_0013s14930g [Populus trichocarpa] Length = 156 Score = 55.1 bits (131), Expect = 3e-06 Identities = 25/37 (67%), Positives = 27/37 (72%) Frame = -2 Query: 473 CDSYLKHITSEKKPSRRDHRTARSGVWQPQLESIHED 363 CD YL I SEKK SRRD RT R GVW+P L+SI ED Sbjct: 120 CDRYLTDIVSEKKSSRRDRRTGRVGVWRPHLQSISED 156 >XP_015874727.1 PREDICTED: uncharacterized protein LOC107411627 [Ziziphus jujuba] Length = 155 Score = 53.9 bits (128), Expect = 7e-06 Identities = 25/37 (67%), Positives = 27/37 (72%) Frame = -2 Query: 473 CDSYLKHITSEKKPSRRDHRTARSGVWQPQLESIHED 363 CD YL I SEKK SRRD R+ R GVW+P LESI ED Sbjct: 119 CDRYLTDIISEKKHSRRDRRSGRVGVWRPHLESISED 155 >XP_015870058.1 PREDICTED: uncharacterized protein LOC107407309 [Ziziphus jujuba] Length = 156 Score = 53.9 bits (128), Expect = 7e-06 Identities = 25/37 (67%), Positives = 27/37 (72%) Frame = -2 Query: 473 CDSYLKHITSEKKPSRRDHRTARSGVWQPQLESIHED 363 CD YL I SEKK SRRD R+ R GVW+P LESI ED Sbjct: 120 CDRYLTDIISEKKHSRRDRRSGRVGVWRPHLESISED 156