BLASTX nr result
ID: Panax25_contig00003975
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00003975 (541 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007017008.2 PREDICTED: uncharacterized protein LOC18591042 [T... 60 4e-08 EOY34627.1 6,7-dimethyl-8-ribityllumazine synthase [Theobroma ca... 57 4e-07 >XP_007017008.2 PREDICTED: uncharacterized protein LOC18591042 [Theobroma cacao] Length = 154 Score = 59.7 bits (143), Expect = 4e-08 Identities = 26/45 (57%), Positives = 33/45 (73%) Frame = -2 Query: 468 NDVVPSEYCDSYLKHITSEKKPLRRDHRTARSGVWQPQLESIHED 334 +DVV ++YCD YL ++ SEKK RRD R+ R GVW+P L SI ED Sbjct: 110 SDVVVTDYCDRYLSNVVSEKKSSRRDRRSGRVGVWRPHLASISED 154 >EOY34627.1 6,7-dimethyl-8-ribityllumazine synthase [Theobroma cacao] Length = 154 Score = 57.0 bits (136), Expect = 4e-07 Identities = 25/45 (55%), Positives = 32/45 (71%) Frame = -2 Query: 468 NDVVPSEYCDSYLKHITSEKKPLRRDHRTARSGVWQPQLESIHED 334 +DVV ++YCD YL ++ SEKK R D R+ R GVW+P L SI ED Sbjct: 110 SDVVVTDYCDRYLSNVVSEKKSSRGDRRSGRVGVWRPHLASISED 154