BLASTX nr result
ID: Panax25_contig00003822
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00003822 (696 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KZN03576.1 hypothetical protein DCAR_012332 [Daucus carota subsp... 79 2e-13 XP_017241966.1 PREDICTED: pentatricopeptide repeat-containing pr... 79 2e-13 KVH94500.1 Pentatricopeptide repeat-containing protein [Cynara c... 75 6e-12 XP_012082926.1 PREDICTED: pentatricopeptide repeat-containing pr... 75 8e-12 KDO86953.1 hypothetical protein CISIN_1g002814mg [Citrus sinensis] 74 2e-11 XP_006444532.1 hypothetical protein CICLE_v10018807mg [Citrus cl... 74 2e-11 XP_016555563.1 PREDICTED: pentatricopeptide repeat-containing pr... 74 2e-11 CDP17054.1 unnamed protein product [Coffea canephora] 74 2e-11 XP_010087216.1 hypothetical protein L484_009725 [Morus notabilis... 74 2e-11 XP_006492356.1 PREDICTED: pentatricopeptide repeat-containing pr... 74 2e-11 XP_006444533.1 hypothetical protein CICLE_v10018807mg [Citrus cl... 74 2e-11 XP_019197514.1 PREDICTED: pentatricopeptide repeat-containing pr... 73 3e-11 XP_019069880.1 PREDICTED: pentatricopeptide repeat-containing pr... 73 3e-11 KJB49788.1 hypothetical protein B456_008G138300 [Gossypium raimo... 73 3e-11 XP_015078966.1 PREDICTED: pentatricopeptide repeat-containing pr... 73 3e-11 XP_004240564.1 PREDICTED: pentatricopeptide repeat-containing pr... 73 3e-11 KHG30653.1 hypothetical protein F383_05807 [Gossypium arboreum] 73 3e-11 XP_007051141.1 PREDICTED: pentatricopeptide repeat-containing pr... 73 4e-11 XP_017637575.1 PREDICTED: pentatricopeptide repeat-containing pr... 73 4e-11 XP_016735679.1 PREDICTED: pentatricopeptide repeat-containing pr... 73 4e-11 >KZN03576.1 hypothetical protein DCAR_012332 [Daucus carota subsp. sativus] Length = 694 Score = 79.3 bits (194), Expect = 2e-13 Identities = 42/71 (59%), Positives = 47/71 (66%) Frame = -1 Query: 675 SCCSSFKEASLLLEELRLFDNQVYGVAHGLLVGHREKVWIQPLQQHLPFILNESLNIDLP 496 S CSSFKEASLLLEELRLFDN VYGVAHGLL+GHRE VW+Q L + +S Sbjct: 473 SRCSSFKEASLLLEELRLFDNHVYGVAHGLLMGHRENVWVQALSLFDDVMQMDSSTASAF 532 Query: 495 YFLLTSFEHYF 463 Y LT +F Sbjct: 533 YNALTDMLWHF 543 >XP_017241966.1 PREDICTED: pentatricopeptide repeat-containing protein At2g31400, chloroplastic [Daucus carota subsp. sativus] Length = 880 Score = 79.3 bits (194), Expect = 2e-13 Identities = 42/71 (59%), Positives = 47/71 (66%) Frame = -1 Query: 675 SCCSSFKEASLLLEELRLFDNQVYGVAHGLLVGHREKVWIQPLQQHLPFILNESLNIDLP 496 S CSSFKEASLLLEELRLFDN VYGVAHGLL+GHRE VW+Q L + +S Sbjct: 659 SRCSSFKEASLLLEELRLFDNHVYGVAHGLLMGHRENVWVQALSLFDDVMQMDSSTASAF 718 Query: 495 YFLLTSFEHYF 463 Y LT +F Sbjct: 719 YNALTDMLWHF 729 >KVH94500.1 Pentatricopeptide repeat-containing protein [Cynara cardunculus var. scolymus] Length = 800 Score = 75.1 bits (183), Expect = 6e-12 Identities = 35/43 (81%), Positives = 39/43 (90%) Frame = -1 Query: 675 SCCSSFKEASLLLEELRLFDNQVYGVAHGLLVGHREKVWIQPL 547 S CSSF+EASLLLEELRLFDNQVYGVAHGLL+G+RE VW+ L Sbjct: 580 SRCSSFEEASLLLEELRLFDNQVYGVAHGLLMGYRENVWVHAL 622 >XP_012082926.1 PREDICTED: pentatricopeptide repeat-containing protein At2g31400, chloroplastic [Jatropha curcas] KDP28278.1 hypothetical protein JCGZ_14049 [Jatropha curcas] Length = 871 Score = 74.7 bits (182), Expect = 8e-12 Identities = 39/71 (54%), Positives = 47/71 (66%) Frame = -1 Query: 675 SCCSSFKEASLLLEELRLFDNQVYGVAHGLLVGHREKVWIQPLQQHLPFILNESLNIDLP 496 S C SF++AS+LLEELRLFDNQVYGVAHGLL+G+RE VW+Q L L +S Sbjct: 650 SLCDSFEDASMLLEELRLFDNQVYGVAHGLLMGYRENVWMQALSLFDEVKLMDSSTASAF 709 Query: 495 YFLLTSFEHYF 463 Y LT +F Sbjct: 710 YNALTDMLWHF 720 >KDO86953.1 hypothetical protein CISIN_1g002814mg [Citrus sinensis] Length = 820 Score = 73.6 bits (179), Expect = 2e-11 Identities = 37/71 (52%), Positives = 48/71 (67%) Frame = -1 Query: 675 SCCSSFKEASLLLEELRLFDNQVYGVAHGLLVGHREKVWIQPLQQHLPFILNESLNIDLP 496 S C+SF++AS+LLEELRLFDNQVYGVAHGLL+G+R+ +W+Q L L +S Sbjct: 656 SRCNSFEDASMLLEELRLFDNQVYGVAHGLLMGYRDNIWVQALSLFDEVKLMDSSTASAF 715 Query: 495 YFLLTSFEHYF 463 Y LT +F Sbjct: 716 YNALTDMLWHF 726 >XP_006444532.1 hypothetical protein CICLE_v10018807mg [Citrus clementina] ESR57772.1 hypothetical protein CICLE_v10018807mg [Citrus clementina] Length = 820 Score = 73.6 bits (179), Expect = 2e-11 Identities = 37/71 (52%), Positives = 48/71 (67%) Frame = -1 Query: 675 SCCSSFKEASLLLEELRLFDNQVYGVAHGLLVGHREKVWIQPLQQHLPFILNESLNIDLP 496 S C+SF++AS+LLEELRLFDNQVYGVAHGLL+G+R+ +W+Q L L +S Sbjct: 656 SRCNSFEDASMLLEELRLFDNQVYGVAHGLLMGYRDNIWVQALSLFDEVKLMDSSTASAF 715 Query: 495 YFLLTSFEHYF 463 Y LT +F Sbjct: 716 YNALTDMLWHF 726 >XP_016555563.1 PREDICTED: pentatricopeptide repeat-containing protein At2g31400, chloroplastic [Capsicum annuum] Length = 836 Score = 73.6 bits (179), Expect = 2e-11 Identities = 36/43 (83%), Positives = 37/43 (86%) Frame = -1 Query: 675 SCCSSFKEASLLLEELRLFDNQVYGVAHGLLVGHREKVWIQPL 547 S CSSF EASLLLEELRLFDNQVYGVAHGLL+G RE VW Q L Sbjct: 614 SRCSSFNEASLLLEELRLFDNQVYGVAHGLLMGQREGVWAQAL 656 >CDP17054.1 unnamed protein product [Coffea canephora] Length = 866 Score = 73.6 bits (179), Expect = 2e-11 Identities = 34/43 (79%), Positives = 39/43 (90%) Frame = -1 Query: 675 SCCSSFKEASLLLEELRLFDNQVYGVAHGLLVGHREKVWIQPL 547 S C+SF+EAS+LLEELRLFDN VYGVAHGLL+GH EKVW+Q L Sbjct: 645 SRCNSFEEASVLLEELRLFDNHVYGVAHGLLMGHDEKVWMQAL 687 >XP_010087216.1 hypothetical protein L484_009725 [Morus notabilis] EXB28566.1 hypothetical protein L484_009725 [Morus notabilis] Length = 871 Score = 73.6 bits (179), Expect = 2e-11 Identities = 32/41 (78%), Positives = 39/41 (95%) Frame = -1 Query: 675 SCCSSFKEASLLLEELRLFDNQVYGVAHGLLVGHREKVWIQ 553 S C+SF++AS+LLEELRLFDNQVYGVAHGLL+GHRE VW++ Sbjct: 651 SRCNSFEDASMLLEELRLFDNQVYGVAHGLLMGHRENVWLE 691 >XP_006492356.1 PREDICTED: pentatricopeptide repeat-containing protein At2g31400, chloroplastic [Citrus sinensis] KDO86952.1 hypothetical protein CISIN_1g002814mg [Citrus sinensis] Length = 877 Score = 73.6 bits (179), Expect = 2e-11 Identities = 37/71 (52%), Positives = 48/71 (67%) Frame = -1 Query: 675 SCCSSFKEASLLLEELRLFDNQVYGVAHGLLVGHREKVWIQPLQQHLPFILNESLNIDLP 496 S C+SF++AS+LLEELRLFDNQVYGVAHGLL+G+R+ +W+Q L L +S Sbjct: 656 SRCNSFEDASMLLEELRLFDNQVYGVAHGLLMGYRDNIWVQALSLFDEVKLMDSSTASAF 715 Query: 495 YFLLTSFEHYF 463 Y LT +F Sbjct: 716 YNALTDMLWHF 726 >XP_006444533.1 hypothetical protein CICLE_v10018807mg [Citrus clementina] ESR57773.1 hypothetical protein CICLE_v10018807mg [Citrus clementina] Length = 877 Score = 73.6 bits (179), Expect = 2e-11 Identities = 37/71 (52%), Positives = 48/71 (67%) Frame = -1 Query: 675 SCCSSFKEASLLLEELRLFDNQVYGVAHGLLVGHREKVWIQPLQQHLPFILNESLNIDLP 496 S C+SF++AS+LLEELRLFDNQVYGVAHGLL+G+R+ +W+Q L L +S Sbjct: 656 SRCNSFEDASMLLEELRLFDNQVYGVAHGLLMGYRDNIWVQALSLFDEVKLMDSSTASAF 715 Query: 495 YFLLTSFEHYF 463 Y LT +F Sbjct: 716 YNALTDMLWHF 726 >XP_019197514.1 PREDICTED: pentatricopeptide repeat-containing protein At2g31400, chloroplastic [Ipomoea nil] XP_019197515.1 PREDICTED: pentatricopeptide repeat-containing protein At2g31400, chloroplastic [Ipomoea nil] Length = 868 Score = 73.2 bits (178), Expect = 3e-11 Identities = 34/43 (79%), Positives = 38/43 (88%) Frame = -1 Query: 675 SCCSSFKEASLLLEELRLFDNQVYGVAHGLLVGHREKVWIQPL 547 S CSSF+EASLLLEELR+FDN VYGVAHGLL+GH E VW+Q L Sbjct: 646 SRCSSFEEASLLLEELRIFDNHVYGVAHGLLMGHCEDVWVQAL 688 >XP_019069880.1 PREDICTED: pentatricopeptide repeat-containing protein At2g31400, chloroplastic isoform X2 [Solanum lycopersicum] Length = 715 Score = 72.8 bits (177), Expect = 3e-11 Identities = 36/43 (83%), Positives = 37/43 (86%) Frame = -1 Query: 675 SCCSSFKEASLLLEELRLFDNQVYGVAHGLLVGHREKVWIQPL 547 S CSSF EASLLLEELRLFDNQVYGVAHGLL+G RE VW Q L Sbjct: 620 SRCSSFDEASLLLEELRLFDNQVYGVAHGLLMGQREGVWSQAL 662 >KJB49788.1 hypothetical protein B456_008G138300 [Gossypium raimondii] Length = 780 Score = 72.8 bits (177), Expect = 3e-11 Identities = 33/41 (80%), Positives = 38/41 (92%) Frame = -1 Query: 675 SCCSSFKEASLLLEELRLFDNQVYGVAHGLLVGHREKVWIQ 553 S C SF++AS+LLEELRLFDNQVYGVAHGLL+G+RE VWIQ Sbjct: 646 SRCDSFEDASMLLEELRLFDNQVYGVAHGLLMGYRENVWIQ 686 >XP_015078966.1 PREDICTED: pentatricopeptide repeat-containing protein At2g31400, chloroplastic [Solanum pennellii] Length = 841 Score = 72.8 bits (177), Expect = 3e-11 Identities = 36/43 (83%), Positives = 37/43 (86%) Frame = -1 Query: 675 SCCSSFKEASLLLEELRLFDNQVYGVAHGLLVGHREKVWIQPL 547 S CSSF EASLLLEELRLFDNQVYGVAHGLL+G RE VW Q L Sbjct: 620 SRCSSFDEASLLLEELRLFDNQVYGVAHGLLMGQREGVWSQAL 662 >XP_004240564.1 PREDICTED: pentatricopeptide repeat-containing protein At2g31400, chloroplastic isoform X1 [Solanum lycopersicum] Length = 841 Score = 72.8 bits (177), Expect = 3e-11 Identities = 36/43 (83%), Positives = 37/43 (86%) Frame = -1 Query: 675 SCCSSFKEASLLLEELRLFDNQVYGVAHGLLVGHREKVWIQPL 547 S CSSF EASLLLEELRLFDNQVYGVAHGLL+G RE VW Q L Sbjct: 620 SRCSSFDEASLLLEELRLFDNQVYGVAHGLLMGQREGVWSQAL 662 >KHG30653.1 hypothetical protein F383_05807 [Gossypium arboreum] Length = 862 Score = 72.8 bits (177), Expect = 3e-11 Identities = 33/41 (80%), Positives = 38/41 (92%) Frame = -1 Query: 675 SCCSSFKEASLLLEELRLFDNQVYGVAHGLLVGHREKVWIQ 553 S C SF++AS+LLEELRLFDNQVYGVAHGLL+G+RE VWIQ Sbjct: 646 SRCDSFEDASMLLEELRLFDNQVYGVAHGLLMGYRENVWIQ 686 >XP_007051141.1 PREDICTED: pentatricopeptide repeat-containing protein At2g31400, chloroplastic [Theobroma cacao] EOX95298.1 S uncoupled 1 [Theobroma cacao] Length = 866 Score = 72.8 bits (177), Expect = 4e-11 Identities = 33/41 (80%), Positives = 38/41 (92%) Frame = -1 Query: 675 SCCSSFKEASLLLEELRLFDNQVYGVAHGLLVGHREKVWIQ 553 S C SF++AS+LLEELRLFDNQVYGVAHGLL+G+RE VWIQ Sbjct: 645 SRCDSFEDASMLLEELRLFDNQVYGVAHGLLMGYRENVWIQ 685 >XP_017637575.1 PREDICTED: pentatricopeptide repeat-containing protein At2g31400, chloroplastic-like [Gossypium arboreum] Length = 867 Score = 72.8 bits (177), Expect = 4e-11 Identities = 33/41 (80%), Positives = 38/41 (92%) Frame = -1 Query: 675 SCCSSFKEASLLLEELRLFDNQVYGVAHGLLVGHREKVWIQ 553 S C SF++AS+LLEELRLFDNQVYGVAHGLL+G+RE VWIQ Sbjct: 646 SRCDSFEDASMLLEELRLFDNQVYGVAHGLLMGYRENVWIQ 686 >XP_016735679.1 PREDICTED: pentatricopeptide repeat-containing protein At2g31400, chloroplastic-like [Gossypium hirsutum] Length = 867 Score = 72.8 bits (177), Expect = 4e-11 Identities = 33/41 (80%), Positives = 38/41 (92%) Frame = -1 Query: 675 SCCSSFKEASLLLEELRLFDNQVYGVAHGLLVGHREKVWIQ 553 S C SF++AS+LLEELRLFDNQVYGVAHGLL+G+RE VWIQ Sbjct: 646 SRCDSFEDASMLLEELRLFDNQVYGVAHGLLMGYRENVWIQ 686