BLASTX nr result
ID: Panax25_contig00003792
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00003792 (1022 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAU41997.1 hypothetical protein TSUD_307030, partial [Trifolium ... 71 4e-12 KIO47654.1 hypothetical protein SQ11_16120, partial [Nitrosospir... 70 6e-12 GAU41995.1 hypothetical protein TSUD_307010 [Trifolium subterran... 72 9e-12 KDO80345.1 hypothetical protein CISIN_1g027593mg [Citrus sinensis] 72 1e-11 JAU85935.1 GTP-binding nuclear protein Ran-3, partial [Noccaea c... 70 1e-11 JAU44869.1 GTP-binding nuclear protein Ran-3, partial [Noccaea c... 70 2e-11 GAU27480.1 hypothetical protein TSUD_14600, partial [Trifolium s... 70 2e-11 GAU27479.1 hypothetical protein TSUD_14590 [Trifolium subterraneum] 70 2e-11 AHH02359.1 putative small ras-related protein, partial [Aegicera... 70 2e-11 XP_011648479.1 PREDICTED: GTP-binding nuclear protein Ran1B-like... 72 2e-11 AIS72784.1 ran-family small GTPase, partial [Rhizophora apiculata] 70 2e-11 ABK55713.1 small ras-related protein, partial [Cucumis sativus] 70 2e-11 KCW79963.1 hypothetical protein EUGRSUZ_C01293 [Eucalyptus grandis] 70 2e-11 JAU05026.1 GTP-binding nuclear protein Ran-3, partial [Noccaea c... 70 2e-11 AGS16672.1 mutant GTP-binding nuclear protein Ran3A, partial [Mu... 70 3e-11 KCW79964.1 hypothetical protein EUGRSUZ_C01293 [Eucalyptus grandis] 70 3e-11 XP_008344088.1 PREDICTED: GTP-binding nuclear protein Ran-B1, pa... 70 4e-11 XP_016164717.1 PREDICTED: GTP-binding nuclear protein Ran1B-like... 70 4e-11 AGS16680.1 GTP-binding nuclear protein Ran3B, partial [Musa AB G... 70 5e-11 AGS16678.1 GTP-binding nuclear protein Ran3A, partial [Musa AB G... 70 5e-11 >GAU41997.1 hypothetical protein TSUD_307030, partial [Trifolium subterraneum] Length = 88 Score = 71.2 bits (173), Expect = 4e-12 Identities = 32/36 (88%), Positives = 32/36 (88%) Frame = -3 Query: 108 RIFT*SIHGQCAIIMFDVTARLTYKNVPTWHRDLCR 1 R T IHGQCAIIMFDVTARLTYKNVPTWHRDLCR Sbjct: 31 RHLTGDIHGQCAIIMFDVTARLTYKNVPTWHRDLCR 66 >KIO47654.1 hypothetical protein SQ11_16120, partial [Nitrosospira sp. NpAV] Length = 61 Score = 70.1 bits (170), Expect = 6e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -3 Query: 90 IHGQCAIIMFDVTARLTYKNVPTWHRDLCR 1 IHGQCAIIMFDVTARLTYKNVPTWHRDLCR Sbjct: 13 IHGQCAIIMFDVTARLTYKNVPTWHRDLCR 42 >GAU41995.1 hypothetical protein TSUD_307010 [Trifolium subterraneum] Length = 128 Score = 71.6 bits (174), Expect = 9e-12 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -3 Query: 93 SIHGQCAIIMFDVTARLTYKNVPTWHRDLCR 1 SIHGQCAIIMFDVTARLTYKNVPTWHRDLCR Sbjct: 76 SIHGQCAIIMFDVTARLTYKNVPTWHRDLCR 106 >KDO80345.1 hypothetical protein CISIN_1g027593mg [Citrus sinensis] Length = 153 Score = 72.0 bits (175), Expect = 1e-11 Identities = 33/40 (82%), Positives = 34/40 (85%) Frame = -3 Query: 120 FKEVRIFT*SIHGQCAIIMFDVTARLTYKNVPTWHRDLCR 1 F + I SIHGQCAIIMFDVTARLTYKNVPTWHRDLCR Sbjct: 6 FNVLIILICSIHGQCAIIMFDVTARLTYKNVPTWHRDLCR 45 >JAU85935.1 GTP-binding nuclear protein Ran-3, partial [Noccaea caerulescens] Length = 96 Score = 70.1 bits (170), Expect = 1e-11 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -3 Query: 90 IHGQCAIIMFDVTARLTYKNVPTWHRDLCR 1 IHGQCAIIMFDVTARLTYKNVPTWHRDLCR Sbjct: 31 IHGQCAIIMFDVTARLTYKNVPTWHRDLCR 60 >JAU44869.1 GTP-binding nuclear protein Ran-3, partial [Noccaea caerulescens] Length = 99 Score = 70.1 bits (170), Expect = 2e-11 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -3 Query: 90 IHGQCAIIMFDVTARLTYKNVPTWHRDLCR 1 IHGQCAIIMFDVTARLTYKNVPTWHRDLCR Sbjct: 34 IHGQCAIIMFDVTARLTYKNVPTWHRDLCR 63 >GAU27480.1 hypothetical protein TSUD_14600, partial [Trifolium subterraneum] Length = 102 Score = 70.1 bits (170), Expect = 2e-11 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -3 Query: 90 IHGQCAIIMFDVTARLTYKNVPTWHRDLCR 1 IHGQCAIIMFDVTARLTYKNVPTWHRDLCR Sbjct: 52 IHGQCAIIMFDVTARLTYKNVPTWHRDLCR 81 >GAU27479.1 hypothetical protein TSUD_14590 [Trifolium subterraneum] Length = 103 Score = 70.1 bits (170), Expect = 2e-11 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -3 Query: 90 IHGQCAIIMFDVTARLTYKNVPTWHRDLCR 1 IHGQCAIIMFDVTARLTYKNVPTWHRDLCR Sbjct: 52 IHGQCAIIMFDVTARLTYKNVPTWHRDLCR 81 >AHH02359.1 putative small ras-related protein, partial [Aegiceras corniculatum] Length = 103 Score = 70.1 bits (170), Expect = 2e-11 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -3 Query: 90 IHGQCAIIMFDVTARLTYKNVPTWHRDLCR 1 IHGQCAIIMFDVTARLTYKNVPTWHRDLCR Sbjct: 40 IHGQCAIIMFDVTARLTYKNVPTWHRDLCR 69 >XP_011648479.1 PREDICTED: GTP-binding nuclear protein Ran1B-like [Cucumis sativus] Length = 160 Score = 71.6 bits (174), Expect = 2e-11 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -3 Query: 93 SIHGQCAIIMFDVTARLTYKNVPTWHRDLCR 1 SIHGQCAIIMFDVTARLTYKNVPTWHRDLCR Sbjct: 22 SIHGQCAIIMFDVTARLTYKNVPTWHRDLCR 52 >AIS72784.1 ran-family small GTPase, partial [Rhizophora apiculata] Length = 107 Score = 70.1 bits (170), Expect = 2e-11 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -3 Query: 90 IHGQCAIIMFDVTARLTYKNVPTWHRDLCR 1 IHGQCAIIMFDVTARLTYKNVPTWHRDLCR Sbjct: 59 IHGQCAIIMFDVTARLTYKNVPTWHRDLCR 88 >ABK55713.1 small ras-related protein, partial [Cucumis sativus] Length = 111 Score = 70.1 bits (170), Expect = 2e-11 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -3 Query: 90 IHGQCAIIMFDVTARLTYKNVPTWHRDLCR 1 IHGQCAIIMFDVTARLTYKNVPTWHRDLCR Sbjct: 5 IHGQCAIIMFDVTARLTYKNVPTWHRDLCR 34 >KCW79963.1 hypothetical protein EUGRSUZ_C01293 [Eucalyptus grandis] Length = 113 Score = 70.1 bits (170), Expect = 2e-11 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -3 Query: 93 SIHGQCAIIMFDVTARLTYKNVPTWHRDLCR 1 SIHGQCAIIMFDVTA+LTYKNVPTWHRDLCR Sbjct: 13 SIHGQCAIIMFDVTAQLTYKNVPTWHRDLCR 43 >JAU05026.1 GTP-binding nuclear protein Ran-3, partial [Noccaea caerulescens] Length = 114 Score = 70.1 bits (170), Expect = 2e-11 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -3 Query: 90 IHGQCAIIMFDVTARLTYKNVPTWHRDLCR 1 IHGQCAIIMFDVTARLTYKNVPTWHRDLCR Sbjct: 49 IHGQCAIIMFDVTARLTYKNVPTWHRDLCR 78 >AGS16672.1 mutant GTP-binding nuclear protein Ran3A, partial [Musa AB Group] Length = 124 Score = 70.1 bits (170), Expect = 3e-11 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -3 Query: 90 IHGQCAIIMFDVTARLTYKNVPTWHRDLCR 1 IHGQCAIIMFDVTARLTYKNVPTWHRDLCR Sbjct: 13 IHGQCAIIMFDVTARLTYKNVPTWHRDLCR 42 >KCW79964.1 hypothetical protein EUGRSUZ_C01293 [Eucalyptus grandis] Length = 129 Score = 70.1 bits (170), Expect = 3e-11 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -3 Query: 93 SIHGQCAIIMFDVTARLTYKNVPTWHRDLCR 1 SIHGQCAIIMFDVTA+LTYKNVPTWHRDLCR Sbjct: 13 SIHGQCAIIMFDVTAQLTYKNVPTWHRDLCR 43 >XP_008344088.1 PREDICTED: GTP-binding nuclear protein Ran-B1, partial [Malus domestica] XP_011069507.1 PREDICTED: GTP-binding nuclear protein Ran-B1, partial [Sesamum indicum] Length = 134 Score = 70.1 bits (170), Expect = 4e-11 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -3 Query: 90 IHGQCAIIMFDVTARLTYKNVPTWHRDLCR 1 IHGQCAIIMFDVTARLTYKNVPTWHRDLCR Sbjct: 84 IHGQCAIIMFDVTARLTYKNVPTWHRDLCR 113 >XP_016164717.1 PREDICTED: GTP-binding nuclear protein Ran1B-like [Arachis ipaensis] Length = 140 Score = 70.1 bits (170), Expect = 4e-11 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -3 Query: 90 IHGQCAIIMFDVTARLTYKNVPTWHRDLCR 1 IHGQCAIIMFDVTARLTYKNVPTWHRDLCR Sbjct: 105 IHGQCAIIMFDVTARLTYKNVPTWHRDLCR 134 >AGS16680.1 GTP-binding nuclear protein Ran3B, partial [Musa AB Group] Length = 150 Score = 70.1 bits (170), Expect = 5e-11 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -3 Query: 90 IHGQCAIIMFDVTARLTYKNVPTWHRDLCR 1 IHGQCAIIMFDVTARLTYKNVPTWHRDLCR Sbjct: 13 IHGQCAIIMFDVTARLTYKNVPTWHRDLCR 42 >AGS16678.1 GTP-binding nuclear protein Ran3A, partial [Musa AB Group] AGS16679.1 GTP-binding nuclear protein Ran3A, partial [Musa AB Group] AGS16681.1 GTP-binding nuclear protein Ran3A, partial [Musa AB Group] Length = 150 Score = 70.1 bits (170), Expect = 5e-11 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -3 Query: 90 IHGQCAIIMFDVTARLTYKNVPTWHRDLCR 1 IHGQCAIIMFDVTARLTYKNVPTWHRDLCR Sbjct: 13 IHGQCAIIMFDVTARLTYKNVPTWHRDLCR 42