BLASTX nr result
ID: Panax25_contig00003413
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00003413 (528 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value OMO62138.1 hypothetical protein COLO4_33201 [Corchorus olitorius] 62 2e-11 EEF27072.1 conserved hypothetical protein [Ricinus communis] 55 3e-07 >OMO62138.1 hypothetical protein COLO4_33201 [Corchorus olitorius] Length = 101 Score = 62.0 bits (149), Expect(2) = 2e-11 Identities = 29/41 (70%), Positives = 32/41 (78%) Frame = -2 Query: 224 PPR*SSSDAARDKFSFKPLSFGSDKSCPFGQFAQVVFPYLP 102 PPR SSS+AA D+ FK LSFGSDK FG+FAQVVFPY P Sbjct: 43 PPRRSSSNAAHDRLRFKALSFGSDKKSTFGRFAQVVFPYFP 83 Score = 34.3 bits (77), Expect(2) = 2e-11 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -3 Query: 115 FLIFPKRSELFWFEKGA 65 F FP+RSELFWFEKGA Sbjct: 79 FPYFPQRSELFWFEKGA 95 >EEF27072.1 conserved hypothetical protein [Ricinus communis] Length = 63 Score = 55.1 bits (131), Expect = 3e-07 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = -2 Query: 209 SSDAARDKFSFKPLSFGSDKSCPFGQFAQV 120 +SDAARD+ SFKPLSFGSDKS PFG+FAQV Sbjct: 5 ASDAARDRLSFKPLSFGSDKSSPFGRFAQV 34