BLASTX nr result
ID: Panax25_contig00003406
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00003406 (718 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017244602.1 PREDICTED: putative F-box protein At1g49610 [Dauc... 88 2e-16 >XP_017244602.1 PREDICTED: putative F-box protein At1g49610 [Daucus carota subsp. sativus] XP_017244603.1 PREDICTED: putative F-box protein At1g49610 [Daucus carota subsp. sativus] KZM99655.1 hypothetical protein DCAR_012983 [Daucus carota subsp. sativus] Length = 499 Score = 88.2 bits (217), Expect = 2e-16 Identities = 51/115 (44%), Positives = 66/115 (57%), Gaps = 4/115 (3%) Frame = -1 Query: 715 DDLRVGISRIHEDNYWNDETWLKSFDFNEEHYFDSQPAFSCLRNHLNTVKIRGCXXXXXX 536 D L VG+S I WNDE WL + EHYF+++P+FSCL N+L TV+I G Sbjct: 383 DSLHVGMSDIFRWEGWNDENWLDESEIGFEHYFETEPSFSCLTNYLRTVRISGARISNCS 442 Query: 535 XXXXXXXLRYSAVLERMEICMK--QSYPSQSSS--AEFSRKLSTCRKASASAMIV 383 L + VLERMEI ++ +Y S SS+ + S LSTCRKAS S +IV Sbjct: 443 LHLVKFLLENAVVLERMEILIRNFNAYSSTSSAELLKLSNLLSTCRKASPSTIIV 497