BLASTX nr result
ID: Panax25_contig00003308
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00003308 (1612 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value YP_009049692.1 hypothetical protein (mitochondrion) [Capsicum an... 69 4e-10 XP_011069463.1 PREDICTED: ATP synthase subunit a, partial [Sesam... 69 1e-08 >YP_009049692.1 hypothetical protein (mitochondrion) [Capsicum annuum] AIG89947.1 hypothetical protein (mitochondrion) [Capsicum annuum] AIG90050.1 hypothetical protein (mitochondrion) [Capsicum annuum] Length = 145 Score = 68.6 bits (166), Expect = 4e-10 Identities = 41/54 (75%), Positives = 43/54 (79%), Gaps = 2/54 (3%) Frame = +1 Query: 1393 YRLSL*ESAGYGLFFLY*ESPGVNSPTDLTPADSREANSL--SRSTLPTRALNE 1548 YRLS G G F ++ ESPGVNSPTDLTPADSREANSL SRSTLPTRALNE Sbjct: 95 YRLS--PVQGMGSFSMF-ESPGVNSPTDLTPADSREANSLSRSRSTLPTRALNE 145 >XP_011069463.1 PREDICTED: ATP synthase subunit a, partial [Sesamum indicum] Length = 421 Score = 68.6 bits (166), Expect = 1e-08 Identities = 36/44 (81%), Positives = 37/44 (84%), Gaps = 3/44 (6%) Frame = +2 Query: 353 YWLMIGFLLV---EFLPLALVPVSSRMSASILERMTWFHVAPLA 475 YWLMI FLLV EFLPLALVPV SRM ASILERMTWFHVA L+ Sbjct: 367 YWLMIKFLLVLLVEFLPLALVPVLSRMPASILERMTWFHVATLS 410