BLASTX nr result
ID: Panax25_contig00003303
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00003303 (371 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value OAY48166.1 hypothetical protein MANES_06G137000 [Manihot esculenta] 55 2e-06 KVH85694.1 Nucleotide-sensitive chloride conductance regulator [... 54 4e-06 XP_011076313.1 PREDICTED: chloride conductance regulatory protei... 54 5e-06 XP_011076312.1 PREDICTED: chloride conductance regulatory protei... 54 5e-06 XP_015878348.1 PREDICTED: chloride conductance regulatory protei... 54 5e-06 XP_007218317.1 hypothetical protein PRUPE_ppa010981mg [Prunus pe... 53 7e-06 XP_009372906.1 PREDICTED: chloride conductance regulatory protei... 53 7e-06 XP_009370493.1 PREDICTED: chloride conductance regulatory protei... 53 7e-06 XP_010101742.1 Chloride conductance regulatory protein ICln [Mor... 53 7e-06 >OAY48166.1 hypothetical protein MANES_06G137000 [Manihot esculenta] Length = 231 Score = 54.7 bits (130), Expect = 2e-06 Identities = 23/32 (71%), Positives = 31/32 (96%) Frame = +1 Query: 121 NDEELMHVETAVSIVLGNRSPQAPGTLYISSK 216 N+EE+MHV+ +VSIV+GNRSP++PGTLYIS+K Sbjct: 25 NEEEIMHVQHSVSIVIGNRSPESPGTLYISTK 56 >KVH85694.1 Nucleotide-sensitive chloride conductance regulator [Cynara cardunculus var. scolymus] Length = 252 Score = 53.9 bits (128), Expect = 4e-06 Identities = 24/33 (72%), Positives = 30/33 (90%) Frame = +1 Query: 118 NNDEELMHVETAVSIVLGNRSPQAPGTLYISSK 216 +N EELMHV+ +VSIVLGNR P++PGTLYIS+K Sbjct: 25 DNGEELMHVQPSVSIVLGNRPPESPGTLYISTK 57 >XP_011076313.1 PREDICTED: chloride conductance regulatory protein ICln isoform X2 [Sesamum indicum] Length = 229 Score = 53.5 bits (127), Expect = 5e-06 Identities = 24/33 (72%), Positives = 29/33 (87%) Frame = +1 Query: 118 NNDEELMHVETAVSIVLGNRSPQAPGTLYISSK 216 +N EELMHV+ VSIVLGNR P++PGTLYIS+K Sbjct: 24 DNGEELMHVQPGVSIVLGNRPPESPGTLYISTK 56 >XP_011076312.1 PREDICTED: chloride conductance regulatory protein ICln isoform X1 [Sesamum indicum] Length = 230 Score = 53.5 bits (127), Expect = 5e-06 Identities = 24/33 (72%), Positives = 29/33 (87%) Frame = +1 Query: 118 NNDEELMHVETAVSIVLGNRSPQAPGTLYISSK 216 +N EELMHV+ VSIVLGNR P++PGTLYIS+K Sbjct: 24 DNGEELMHVQPGVSIVLGNRPPESPGTLYISTK 56 >XP_015878348.1 PREDICTED: chloride conductance regulatory protein ICln [Ziziphus jujuba] Length = 231 Score = 53.5 bits (127), Expect = 5e-06 Identities = 24/33 (72%), Positives = 29/33 (87%) Frame = +1 Query: 118 NNDEELMHVETAVSIVLGNRSPQAPGTLYISSK 216 +N EELMHV+ VSIVLGNR P++PGTLYIS+K Sbjct: 24 DNGEELMHVQPGVSIVLGNRPPESPGTLYISTK 56 >XP_007218317.1 hypothetical protein PRUPE_ppa010981mg [Prunus persica] ONI25105.1 hypothetical protein PRUPE_2G281200 [Prunus persica] ONI25106.1 hypothetical protein PRUPE_2G281200 [Prunus persica] Length = 228 Score = 53.1 bits (126), Expect = 7e-06 Identities = 24/32 (75%), Positives = 28/32 (87%) Frame = +1 Query: 121 NDEELMHVETAVSIVLGNRSPQAPGTLYISSK 216 N EELMHV+ VSIVLGNR P++PGTLYIS+K Sbjct: 26 NGEELMHVQPCVSIVLGNRPPESPGTLYISTK 57 >XP_009372906.1 PREDICTED: chloride conductance regulatory protein ICln-like [Pyrus x bretschneideri] XP_009372907.1 PREDICTED: chloride conductance regulatory protein ICln-like [Pyrus x bretschneideri] Length = 230 Score = 53.1 bits (126), Expect = 7e-06 Identities = 24/32 (75%), Positives = 28/32 (87%) Frame = +1 Query: 121 NDEELMHVETAVSIVLGNRSPQAPGTLYISSK 216 N EELMHV+ VSIVLGNR P++PGTLYIS+K Sbjct: 26 NGEELMHVQPGVSIVLGNRPPESPGTLYISTK 57 >XP_009370493.1 PREDICTED: chloride conductance regulatory protein ICln-like [Pyrus x bretschneideri] XP_009370494.1 PREDICTED: chloride conductance regulatory protein ICln-like [Pyrus x bretschneideri] Length = 230 Score = 53.1 bits (126), Expect = 7e-06 Identities = 24/32 (75%), Positives = 28/32 (87%) Frame = +1 Query: 121 NDEELMHVETAVSIVLGNRSPQAPGTLYISSK 216 N EELMHV+ VSIVLGNR P++PGTLYIS+K Sbjct: 26 NGEELMHVQPGVSIVLGNRPPESPGTLYISTK 57 >XP_010101742.1 Chloride conductance regulatory protein ICln [Morus notabilis] EXB89497.1 Chloride conductance regulatory protein ICln [Morus notabilis] Length = 231 Score = 53.1 bits (126), Expect = 7e-06 Identities = 24/32 (75%), Positives = 28/32 (87%) Frame = +1 Query: 121 NDEELMHVETAVSIVLGNRSPQAPGTLYISSK 216 N EELMHV+ VSIVLGNR P++PGTLYIS+K Sbjct: 25 NGEELMHVQRGVSIVLGNRPPESPGTLYISTK 56