BLASTX nr result
ID: Panax25_contig00003236
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00003236 (744 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KZN00064.1 hypothetical protein DCAR_008818 [Daucus carota subsp... 59 7e-08 KZM99846.1 hypothetical protein DCAR_012792 [Daucus carota subsp... 59 2e-06 XP_017248536.1 PREDICTED: low-temperature-induced cysteine prote... 59 2e-06 BAD29960.1 cysteine protease [Daucus carota] 59 2e-06 XP_017241996.1 PREDICTED: low-temperature-induced cysteine prote... 59 2e-06 >KZN00064.1 hypothetical protein DCAR_008818 [Daucus carota subsp. sativus] Length = 83 Score = 58.5 bits (140), Expect = 7e-08 Identities = 25/31 (80%), Positives = 30/31 (96%) Frame = +2 Query: 623 SKNNPLGVKAMKRILATPNWQHGSEGKRVSA 715 S NNPLGVKA++RILATPNWQHGS+GK+V+A Sbjct: 53 SNNNPLGVKAIQRILATPNWQHGSKGKKVTA 83 >KZM99846.1 hypothetical protein DCAR_012792 [Daucus carota subsp. sativus] Length = 344 Score = 58.5 bits (140), Expect = 2e-06 Identities = 25/31 (80%), Positives = 30/31 (96%) Frame = +2 Query: 623 SKNNPLGVKAMKRILATPNWQHGSEGKRVSA 715 S NNPLGVKA++RILATPNWQHGS+GK+V+A Sbjct: 314 SNNNPLGVKAIQRILATPNWQHGSKGKKVTA 344 >XP_017248536.1 PREDICTED: low-temperature-induced cysteine proteinase-like [Daucus carota subsp. sativus] Length = 460 Score = 58.5 bits (140), Expect = 2e-06 Identities = 25/31 (80%), Positives = 30/31 (96%) Frame = +2 Query: 623 SKNNPLGVKAMKRILATPNWQHGSEGKRVSA 715 S NNPLGVKA++RILATPNWQHGS+GK+V+A Sbjct: 430 SNNNPLGVKAIQRILATPNWQHGSKGKKVTA 460 >BAD29960.1 cysteine protease [Daucus carota] Length = 460 Score = 58.5 bits (140), Expect = 2e-06 Identities = 25/31 (80%), Positives = 30/31 (96%) Frame = +2 Query: 623 SKNNPLGVKAMKRILATPNWQHGSEGKRVSA 715 S NNPLGVKA++RILATPNWQHGS+GK+V+A Sbjct: 430 SNNNPLGVKAIQRILATPNWQHGSKGKKVTA 460 >XP_017241996.1 PREDICTED: low-temperature-induced cysteine proteinase-like [Daucus carota subsp. sativus] Length = 461 Score = 58.5 bits (140), Expect = 2e-06 Identities = 25/31 (80%), Positives = 30/31 (96%) Frame = +2 Query: 623 SKNNPLGVKAMKRILATPNWQHGSEGKRVSA 715 S NNPLGVKA++RILATPNWQHGS+GK+V+A Sbjct: 431 SNNNPLGVKAIQRILATPNWQHGSKGKKVTA 461