BLASTX nr result
ID: Panax25_contig00001527
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00001527 (695 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017218516.1 PREDICTED: nuclear poly(A) polymerase 4-like [Dau... 64 4e-08 KZN06750.1 hypothetical protein DCAR_007587 [Daucus carota subsp... 57 5e-06 >XP_017218516.1 PREDICTED: nuclear poly(A) polymerase 4-like [Daucus carota subsp. sativus] KZM89280.1 hypothetical protein DCAR_026355 [Daucus carota subsp. sativus] Length = 707 Score = 63.5 bits (153), Expect = 4e-08 Identities = 32/44 (72%), Positives = 34/44 (77%) Frame = +1 Query: 280 SVIGSNSHRFSQTDSCEADSELLMNDGCATDGQISEGGSQDELE 411 SV SNS SQ DSCEADSE LMNDGCA DG++SE GS DELE Sbjct: 648 SVGCSNSRVSSQGDSCEADSETLMNDGCAIDGKVSESGSNDELE 691 >KZN06750.1 hypothetical protein DCAR_007587 [Daucus carota subsp. sativus] Length = 555 Score = 57.4 bits (137), Expect = 5e-06 Identities = 26/46 (56%), Positives = 36/46 (78%) Frame = +1 Query: 277 GSVIGSNSHRFSQTDSCEADSELLMNDGCATDGQISEGGSQDELEV 414 GS++ S+S DSCE++S LLM+DGCA DG++SE GS+DELE+ Sbjct: 495 GSILCSSSQVSPHGDSCESESGLLMHDGCAIDGKVSESGSKDELEL 540