BLASTX nr result
ID: Panax25_contig00001315
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00001315 (485 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value JAT49317.1 Cysteine proteinase inhibitor 12 [Anthurium amnicola] 73 1e-21 OAY53339.1 hypothetical protein MANES_04G155400 [Manihot esculenta] 68 8e-19 XP_015897966.1 PREDICTED: cysteine proteinase inhibitor 12-like ... 64 1e-18 CAG29024.1 TPA: putative cystatin [Zea mays] 61 6e-18 NP_001295431.1 cystatin 4 precursor [Zea mays] ACF85991.1 unknow... 61 6e-18 ACG33316.1 multidomain cystatin [Zea mays] 61 6e-18 CAJ20026.1 putative cystatin, partial [Zea mays] 61 6e-18 AAL79831.1 cystatin [Sandersonia aurantiaca] 76 4e-15 XP_004147084.1 PREDICTED: cysteine proteinase inhibitor 12 [Cucu... 77 4e-14 XP_008445944.1 PREDICTED: cysteine proteinase inhibitor 12 [Cucu... 77 4e-14 AFC88844.1 putative cysteine proteinase inhibitor, partial [Tetr... 73 6e-14 XP_008245659.1 PREDICTED: cysteine proteinase inhibitor 12-like ... 75 7e-14 XP_003628013.1 cysteine protease inhibitor cystatin [Medicago tr... 76 9e-14 XP_007220532.1 hypothetical protein PRUPE_ppa010412mg [Prunus pe... 75 2e-13 XP_019107421.1 PREDICTED: cysteine proteinase inhibitor 6-like i... 74 2e-13 XP_019434748.1 PREDICTED: cysteine proteinase inhibitor 6-like [... 75 3e-13 XP_008245514.1 PREDICTED: cysteine proteinase inhibitor 12-like ... 75 3e-13 XP_019103585.1 PREDICTED: cysteine proteinase inhibitor 6 isofor... 74 4e-13 XP_010111219.1 Cysteine proteinase inhibitor 6 [Morus notabilis]... 58 5e-13 XP_015876123.1 PREDICTED: cysteine proteinase inhibitor 12 [Zizi... 74 5e-13 >JAT49317.1 Cysteine proteinase inhibitor 12 [Anthurium amnicola] Length = 245 Score = 73.2 bits (178), Expect(2) = 1e-21 Identities = 37/55 (67%), Positives = 45/55 (81%), Gaps = 3/55 (5%) Frame = +2 Query: 86 LIWVLR---KVIEESAKFDMLLKVKRGDKEEKFKVEVHKNDEGDFHLNQMISDNA 241 L+ +LR +VIE+ AKFD+LLK+KRG KEEKFKVEVHKN EG FHLNQM D++ Sbjct: 191 LLEILRAKAEVIEDHAKFDLLLKLKRGSKEEKFKVEVHKNMEGTFHLNQMEQDHS 245 Score = 57.4 bits (137), Expect(2) = 1e-21 Identities = 23/35 (65%), Positives = 29/35 (82%) Frame = +1 Query: 1 AKIWVKPWLNFKELQEFKHAGDSPSITPSDLGAKK 105 AK+WV+ WLN K+L EF AGDSPS+TP+DLG K+ Sbjct: 117 AKVWVRAWLNSKQLHEFNPAGDSPSVTPADLGVKR 151 >OAY53339.1 hypothetical protein MANES_04G155400 [Manihot esculenta] Length = 231 Score = 67.8 bits (164), Expect(2) = 8e-19 Identities = 33/58 (56%), Positives = 42/58 (72%) Frame = +2 Query: 53 SMPVIPPQSPLLIWVLRKVIEESAKFDMLLKVKRGDKEEKFKVEVHKNDEGDFHLNQM 226 S + P + ++ +V++E AKFDMLLKVKRG EEK+KVEVHKN+EG F LNQM Sbjct: 170 SNSLFPYELKEIVCAKAEVVDEHAKFDMLLKVKRGTSEEKYKVEVHKNNEGSFLLNQM 227 Score = 53.1 bits (126), Expect(2) = 8e-19 Identities = 22/22 (100%), Positives = 22/22 (100%) Frame = +1 Query: 1 AKIWVKPWLNFKELQEFKHAGD 66 AKIWVKPWLNFKELQEFKHAGD Sbjct: 112 AKIWVKPWLNFKELQEFKHAGD 133 >XP_015897966.1 PREDICTED: cysteine proteinase inhibitor 12-like [Ziziphus jujuba] Length = 225 Score = 63.5 bits (153), Expect(2) = 1e-18 Identities = 30/52 (57%), Positives = 42/52 (80%) Frame = +2 Query: 86 LIWVLRKVIEESAKFDMLLKVKRGDKEEKFKVEVHKNDEGDFHLNQMISDNA 241 +++ KVIE+ KF++LLKVKRG KEEKF+VEV+KN EG F+L+QM D++ Sbjct: 174 ILFAKAKVIEDYVKFELLLKVKRGIKEEKFRVEVNKNIEGKFYLSQMEQDSS 225 Score = 57.0 bits (136), Expect(2) = 1e-18 Identities = 23/37 (62%), Positives = 30/37 (81%) Frame = +1 Query: 1 AKIWVKPWLNFKELQEFKHAGDSPSITPSDLGAKKGY 111 AK+WVKPW++FK+LQEFK+ D S TPSD G K+G+ Sbjct: 102 AKVWVKPWMSFKQLQEFKYVHDVSSFTPSDPGLKQGW 138 >CAG29024.1 TPA: putative cystatin [Zea mays] Length = 247 Score = 61.2 bits (147), Expect(2) = 6e-18 Identities = 25/36 (69%), Positives = 31/36 (86%) Frame = +1 Query: 1 AKIWVKPWLNFKELQEFKHAGDSPSITPSDLGAKKG 108 AK+WVKPWL+FKELQEF H GD+ + T +DLGAK+G Sbjct: 113 AKVWVKPWLDFKELQEFSHKGDATAFTNADLGAKEG 148 Score = 56.6 bits (135), Expect(2) = 6e-18 Identities = 29/49 (59%), Positives = 38/49 (77%), Gaps = 3/49 (6%) Frame = +2 Query: 86 LIWVLR---KVIEESAKFDMLLKVKRGDKEEKFKVEVHKNDEGDFHLNQ 223 L+ +LR +V+E+ AKFD+L+K+KRG KEEK K EVHK+ EG F LNQ Sbjct: 187 LLEILRAHAQVVEDFAKFDILMKLKRGSKEEKIKAEVHKSLEGAFVLNQ 235 >NP_001295431.1 cystatin 4 precursor [Zea mays] ACF85991.1 unknown [Zea mays] ACG32708.1 multidomain cystatin [Zea mays] AQK89345.1 cystatin4 [Zea mays] AQK89346.1 cystatin4 [Zea mays] Length = 245 Score = 61.2 bits (147), Expect(2) = 6e-18 Identities = 25/36 (69%), Positives = 31/36 (86%) Frame = +1 Query: 1 AKIWVKPWLNFKELQEFKHAGDSPSITPSDLGAKKG 108 AK+WVKPWL+FKELQEF H GD+ + T +DLGAK+G Sbjct: 111 AKVWVKPWLDFKELQEFSHKGDATAFTNADLGAKQG 146 Score = 56.6 bits (135), Expect(2) = 6e-18 Identities = 29/49 (59%), Positives = 38/49 (77%), Gaps = 3/49 (6%) Frame = +2 Query: 86 LIWVLR---KVIEESAKFDMLLKVKRGDKEEKFKVEVHKNDEGDFHLNQ 223 L+ +LR +V+E+ AKFD+L+K+KRG KEEK K EVHK+ EG F LNQ Sbjct: 185 LLEILRAHAQVVEDFAKFDILMKLKRGSKEEKIKAEVHKSLEGAFVLNQ 233 >ACG33316.1 multidomain cystatin [Zea mays] Length = 243 Score = 61.2 bits (147), Expect(2) = 6e-18 Identities = 25/36 (69%), Positives = 31/36 (86%) Frame = +1 Query: 1 AKIWVKPWLNFKELQEFKHAGDSPSITPSDLGAKKG 108 AK+WVKPWL+FKELQEF H GD+ + T +DLGAK+G Sbjct: 109 AKVWVKPWLDFKELQEFSHKGDATAFTNADLGAKQG 144 Score = 56.6 bits (135), Expect(2) = 6e-18 Identities = 29/49 (59%), Positives = 38/49 (77%), Gaps = 3/49 (6%) Frame = +2 Query: 86 LIWVLR---KVIEESAKFDMLLKVKRGDKEEKFKVEVHKNDEGDFHLNQ 223 L+ +LR +V+E+ AKFD+L+K+KRG KEEK K EVHK+ EG F LNQ Sbjct: 183 LLEILRAHAQVVEDFAKFDILMKLKRGSKEEKIKAEVHKSLEGAFVLNQ 231 >CAJ20026.1 putative cystatin, partial [Zea mays] Length = 226 Score = 61.2 bits (147), Expect(2) = 6e-18 Identities = 25/36 (69%), Positives = 31/36 (86%) Frame = +1 Query: 1 AKIWVKPWLNFKELQEFKHAGDSPSITPSDLGAKKG 108 AK+WVKPWL+FKELQEF H GD+ + T +DLGAK+G Sbjct: 104 AKVWVKPWLDFKELQEFSHKGDATAFTNADLGAKQG 139 Score = 56.6 bits (135), Expect(2) = 6e-18 Identities = 29/49 (59%), Positives = 38/49 (77%), Gaps = 3/49 (6%) Frame = +2 Query: 86 LIWVLR---KVIEESAKFDMLLKVKRGDKEEKFKVEVHKNDEGDFHLNQ 223 L+ +LR +V+E+ AKFD+L+K+KRG KEEK K EVHK+ EG F LNQ Sbjct: 178 LLEILRAHAQVVEDFAKFDILMKLKRGSKEEKIKAEVHKSLEGAFVLNQ 226 >AAL79831.1 cystatin [Sandersonia aurantiaca] Length = 110 Score = 76.3 bits (186), Expect = 4e-15 Identities = 31/36 (86%), Positives = 36/36 (100%) Frame = +1 Query: 1 AKIWVKPWLNFKELQEFKHAGDSPSITPSDLGAKKG 108 AK+WVKPWLNFKELQEF+HAGDSPS+TP+DLGAK+G Sbjct: 74 AKVWVKPWLNFKELQEFRHAGDSPSVTPADLGAKRG 109 >XP_004147084.1 PREDICTED: cysteine proteinase inhibitor 12 [Cucumis sativus] KGN51606.1 hypothetical protein Csa_5G583360 [Cucumis sativus] Length = 249 Score = 77.0 bits (188), Expect = 4e-14 Identities = 37/69 (53%), Positives = 52/69 (75%) Frame = +2 Query: 35 RNCKSSSMPVIPPQSPLLIWVLRKVIEESAKFDMLLKVKRGDKEEKFKVEVHKNDEGDFH 214 R + S ++P + +I +VIE++AKFD+LLK+KRG KEEKFKVEVHKN+EG+F Sbjct: 181 RTIQQRSNSLVPYELLEIIHAKAEVIEDAAKFDLLLKLKRGSKEEKFKVEVHKNNEGNFL 240 Query: 215 LNQMISDNA 241 LNQM+ D++ Sbjct: 241 LNQMVQDHS 249 Score = 73.9 bits (180), Expect = 6e-13 Identities = 32/36 (88%), Positives = 34/36 (94%) Frame = +1 Query: 1 AKIWVKPWLNFKELQEFKHAGDSPSITPSDLGAKKG 108 AK+WVK W+NFKELQEFKHAGD PSITPSDLGAKKG Sbjct: 121 AKVWVKSWMNFKELQEFKHAGDVPSITPSDLGAKKG 156 >XP_008445944.1 PREDICTED: cysteine proteinase inhibitor 12 [Cucumis melo] Length = 250 Score = 77.0 bits (188), Expect = 4e-14 Identities = 37/69 (53%), Positives = 52/69 (75%) Frame = +2 Query: 35 RNCKSSSMPVIPPQSPLLIWVLRKVIEESAKFDMLLKVKRGDKEEKFKVEVHKNDEGDFH 214 R + S ++P + +I +VIE++AKFD+LLK+KRG KEEKFKVEVHKN+EG+F Sbjct: 182 RTIQQRSNSLVPYELLEIIHAKAEVIEDAAKFDLLLKLKRGSKEEKFKVEVHKNNEGNFL 241 Query: 215 LNQMISDNA 241 LNQM+ D++ Sbjct: 242 LNQMVQDHS 250 Score = 72.4 bits (176), Expect = 2e-12 Identities = 31/36 (86%), Positives = 34/36 (94%) Frame = +1 Query: 1 AKIWVKPWLNFKELQEFKHAGDSPSITPSDLGAKKG 108 AK+WVK W+NFKELQEFKHAGD PSI+PSDLGAKKG Sbjct: 122 AKVWVKSWMNFKELQEFKHAGDVPSISPSDLGAKKG 157 >AFC88844.1 putative cysteine proteinase inhibitor, partial [Tetragonia tetragonioides] Length = 107 Score = 73.2 bits (178), Expect = 6e-14 Identities = 31/35 (88%), Positives = 34/35 (97%) Frame = +1 Query: 1 AKIWVKPWLNFKELQEFKHAGDSPSITPSDLGAKK 105 AK+WVKPW+NFKELQEFKHA DSPSITPSDLGAK+ Sbjct: 24 AKVWVKPWMNFKELQEFKHADDSPSITPSDLGAKR 58 >XP_008245659.1 PREDICTED: cysteine proteinase inhibitor 12-like [Prunus mume] Length = 166 Score = 74.7 bits (182), Expect = 7e-14 Identities = 37/69 (53%), Positives = 51/69 (73%) Frame = +2 Query: 35 RNCKSSSMPVIPPQSPLLIWVLRKVIEESAKFDMLLKVKRGDKEEKFKVEVHKNDEGDFH 214 ++ + S + P + ++ +VIEE AKF+MLLK+KRGDKEEKFKVEVHKN+EG F Sbjct: 98 KSLQQRSNSLFPYELQEVVHAKAEVIEEHAKFNMLLKLKRGDKEEKFKVEVHKNNEGAFK 157 Query: 215 LNQMISDNA 241 LNQM +D++ Sbjct: 158 LNQMEADHS 166 Score = 63.2 bits (152), Expect = 2e-09 Identities = 27/39 (69%), Positives = 33/39 (84%), Gaps = 3/39 (7%) Frame = +1 Query: 1 AKIWVKPWLNFKELQEFKHAGD---SPSITPSDLGAKKG 108 AK+WVKPW+ FKE+QEFKHAGD +PS TPS+LG K+G Sbjct: 35 AKVWVKPWMGFKEVQEFKHAGDCNETPSFTPSELGVKEG 73 >XP_003628013.1 cysteine protease inhibitor cystatin [Medicago truncatula] AET02489.1 cysteine protease inhibitor cystatin [Medicago truncatula] Length = 241 Score = 75.9 bits (185), Expect = 9e-14 Identities = 34/46 (73%), Positives = 43/46 (93%) Frame = +2 Query: 104 KVIEESAKFDMLLKVKRGDKEEKFKVEVHKNDEGDFHLNQMISDNA 241 +VI+++AKF++LLKVKRG KEEKFKVEVHKN EG+FHLNQM +DN+ Sbjct: 196 EVIDDTAKFNLLLKVKRGQKEEKFKVEVHKNSEGNFHLNQMEADNS 241 Score = 59.3 bits (142), Expect = 1e-07 Identities = 27/37 (72%), Positives = 30/37 (81%), Gaps = 2/37 (5%) Frame = +1 Query: 1 AKIWVKPWLNFKELQEFKHAGD--SPSITPSDLGAKK 105 AK+WVKPW+NFKEL EFKHAGD +PS T SDLG K Sbjct: 111 AKVWVKPWMNFKELTEFKHAGDGHAPSFTTSDLGVIK 147 >XP_007220532.1 hypothetical protein PRUPE_ppa010412mg [Prunus persica] ONI21038.1 hypothetical protein PRUPE_2G047100 [Prunus persica] Length = 250 Score = 75.1 bits (183), Expect = 2e-13 Identities = 37/69 (53%), Positives = 51/69 (73%) Frame = +2 Query: 35 RNCKSSSMPVIPPQSPLLIWVLRKVIEESAKFDMLLKVKRGDKEEKFKVEVHKNDEGDFH 214 ++ + S + P + ++ +VIEE AKF+MLLK+KRGDKEEKFKVEVHKN+EG F Sbjct: 182 KSLQQRSNSLFPYELQEVVHAKAEVIEEHAKFNMLLKLKRGDKEEKFKVEVHKNNEGTFK 241 Query: 215 LNQMISDNA 241 LNQM +D++ Sbjct: 242 LNQMEADHS 250 Score = 65.5 bits (158), Expect = 8e-10 Identities = 29/39 (74%), Positives = 33/39 (84%), Gaps = 3/39 (7%) Frame = +1 Query: 1 AKIWVKPWLNFKELQEFKHAGD---SPSITPSDLGAKKG 108 AK+WVKPWL FKE+QEFKHAGD +PS TPSDLG K+G Sbjct: 119 AKVWVKPWLGFKEVQEFKHAGDCNETPSFTPSDLGVKEG 157 >XP_019107421.1 PREDICTED: cysteine proteinase inhibitor 6-like isoform X2 [Beta vulgaris subsp. vulgaris] Length = 212 Score = 74.3 bits (181), Expect = 2e-13 Identities = 32/37 (86%), Positives = 35/37 (94%) Frame = +1 Query: 1 AKIWVKPWLNFKELQEFKHAGDSPSITPSDLGAKKGY 111 AK+WVKPW+NFKELQEFKHA DSPSITPSDLGA KG+ Sbjct: 118 AKVWVKPWMNFKELQEFKHADDSPSITPSDLGAIKGH 154 >XP_019434748.1 PREDICTED: cysteine proteinase inhibitor 6-like [Lupinus angustifolius] XP_019434749.1 PREDICTED: cysteine proteinase inhibitor 6-like [Lupinus angustifolius] OIV89378.1 hypothetical protein TanjilG_22341 [Lupinus angustifolius] Length = 243 Score = 74.7 bits (182), Expect = 3e-13 Identities = 36/69 (52%), Positives = 51/69 (73%) Frame = +2 Query: 35 RNCKSSSMPVIPPQSPLLIWVLRKVIEESAKFDMLLKVKRGDKEEKFKVEVHKNDEGDFH 214 + + S ++P + ++ +VI++ AKF++LLKVKRGDKEEKFKVEVHKN+EG FH Sbjct: 175 KTIQQRSNSLVPYELHEVVDAKAEVIDDFAKFNLLLKVKRGDKEEKFKVEVHKNNEGGFH 234 Query: 215 LNQMISDNA 241 LNQM D++ Sbjct: 235 LNQMEHDHS 243 Score = 62.8 bits (151), Expect = 7e-09 Identities = 26/35 (74%), Positives = 29/35 (82%) Frame = +1 Query: 1 AKIWVKPWLNFKELQEFKHAGDSPSITPSDLGAKK 105 AK+WVKPWLNFKEL EFKH D+PS T +DLG KK Sbjct: 115 AKVWVKPWLNFKELTEFKHVADAPSFTSADLGLKK 149 >XP_008245514.1 PREDICTED: cysteine proteinase inhibitor 12-like [Prunus mume] Length = 250 Score = 74.7 bits (182), Expect = 3e-13 Identities = 37/69 (53%), Positives = 51/69 (73%) Frame = +2 Query: 35 RNCKSSSMPVIPPQSPLLIWVLRKVIEESAKFDMLLKVKRGDKEEKFKVEVHKNDEGDFH 214 ++ + S + P + ++ +VIEE AKF+MLLK+KRGDKEEKFKVEVHKN+EG F Sbjct: 182 KSLQQRSNSLFPYELQEVVHAKAEVIEEHAKFNMLLKLKRGDKEEKFKVEVHKNNEGAFK 241 Query: 215 LNQMISDNA 241 LNQM +D++ Sbjct: 242 LNQMEADHS 250 Score = 64.7 bits (156), Expect = 1e-09 Identities = 28/39 (71%), Positives = 33/39 (84%), Gaps = 3/39 (7%) Frame = +1 Query: 1 AKIWVKPWLNFKELQEFKHAGD---SPSITPSDLGAKKG 108 AK+WVKPW+ FKE+QEFKHAGD +PS TPSDLG K+G Sbjct: 119 AKVWVKPWMGFKEVQEFKHAGDCNETPSFTPSDLGVKEG 157 >XP_019103585.1 PREDICTED: cysteine proteinase inhibitor 6 isoform X2 [Beta vulgaris subsp. vulgaris] Length = 249 Score = 74.3 bits (181), Expect = 4e-13 Identities = 32/37 (86%), Positives = 35/37 (94%) Frame = +1 Query: 1 AKIWVKPWLNFKELQEFKHAGDSPSITPSDLGAKKGY 111 AK+WVKPW+NFKELQEFKHA DSPSITPSDLGA KG+ Sbjct: 118 AKVWVKPWMNFKELQEFKHADDSPSITPSDLGAIKGH 154 Score = 61.6 bits (148), Expect = 2e-08 Identities = 27/41 (65%), Positives = 38/41 (92%) Frame = +2 Query: 104 KVIEESAKFDMLLKVKRGDKEEKFKVEVHKNDEGDFHLNQM 226 +V+E++AKF++ LKVKRG+KEE F VEVHKN+EG+++LNQM Sbjct: 200 EVVEDTAKFNLHLKVKRGNKEEIFNVEVHKNNEGNYNLNQM 240 >XP_010111219.1 Cysteine proteinase inhibitor 6 [Morus notabilis] EXC30697.1 Cysteine proteinase inhibitor 6 [Morus notabilis] Length = 221 Score = 57.8 bits (138), Expect(2) = 5e-13 Identities = 24/34 (70%), Positives = 28/34 (82%) Frame = +1 Query: 1 AKIWVKPWLNFKELQEFKHAGDSPSITPSDLGAK 102 A++WVKPW+NFK+LQEFK A D PS T SDLG K Sbjct: 102 ARVWVKPWMNFKQLQEFKFAHDVPSFTSSDLGVK 135 Score = 43.5 bits (101), Expect(2) = 5e-13 Identities = 21/41 (51%), Positives = 32/41 (78%) Frame = +2 Query: 104 KVIEESAKFDMLLKVKRGDKEEKFKVEVHKNDEGDFHLNQM 226 KVIE+ KF++LLKVKRG KEE F+ +++KN G + L+++ Sbjct: 176 KVIEDHVKFELLLKVKRGIKEEIFRFDLNKNFIGWYCLSRV 216 >XP_015876123.1 PREDICTED: cysteine proteinase inhibitor 12 [Ziziphus jujuba] Length = 225 Score = 73.6 bits (179), Expect = 5e-13 Identities = 33/46 (71%), Positives = 42/46 (91%) Frame = +2 Query: 104 KVIEESAKFDMLLKVKRGDKEEKFKVEVHKNDEGDFHLNQMISDNA 241 +VI++SAKFD+LLKVKRGDKEEK+K EVHKN EG+FHLNQ+ D++ Sbjct: 180 EVIDDSAKFDILLKVKRGDKEEKYKAEVHKNIEGNFHLNQIAPDHS 225 Score = 62.8 bits (151), Expect = 6e-09 Identities = 28/36 (77%), Positives = 32/36 (88%), Gaps = 1/36 (2%) Frame = +1 Query: 1 AKIWVKPWLNFKELQEFKHAGD-SPSITPSDLGAKK 105 AK+WVKPW++FKELQEFKHAGD SPS T SDLG K+ Sbjct: 96 AKVWVKPWMDFKELQEFKHAGDASPSFTSSDLGVKQ 131