BLASTX nr result
ID: Panax25_contig00001167
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00001167 (354 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017218431.1 PREDICTED: squamosa promoter-binding-like protein... 92 2e-19 XP_017218430.1 PREDICTED: squamosa promoter-binding-like protein... 92 2e-19 XP_017218515.1 PREDICTED: squamosa promoter-binding-like protein... 92 2e-19 XP_011034772.1 PREDICTED: squamosa promoter-binding-like protein... 92 3e-19 XP_011034771.1 PREDICTED: squamosa promoter-binding-like protein... 92 3e-19 XP_002301891.1 SPL1-Related3 family protein [Populus trichocarpa... 91 5e-19 XP_008453037.1 PREDICTED: squamosa promoter-binding-like protein... 91 9e-19 XP_004145609.1 PREDICTED: squamosa promoter-binding-like protein... 91 9e-19 ALF46641.1 SBP-like protein, partial [Chrysanthemum x morifolium] 88 5e-18 KVI07573.1 Ankyrin repeat-containing protein [Cynara cardunculus... 88 5e-18 XP_017188218.1 PREDICTED: squamosa promoter-binding-like protein... 88 6e-18 XP_011041129.1 PREDICTED: squamosa promoter-binding-like protein... 88 6e-18 XP_009372667.1 PREDICTED: squamosa promoter-binding-like protein... 88 6e-18 XP_002307005.2 hypothetical protein POPTR_0005s28010g [Populus t... 87 1e-17 CBI40788.3 unnamed protein product, partial [Vitis vinifera] 87 2e-17 XP_002273784.1 PREDICTED: squamosa promoter-binding-like protein... 87 2e-17 XP_002510746.1 PREDICTED: squamosa promoter-binding-like protein... 87 2e-17 XP_015879984.1 PREDICTED: squamosa promoter-binding-like protein... 86 3e-17 XP_012073540.1 PREDICTED: squamosa promoter-binding-like protein... 86 3e-17 OAY50366.1 hypothetical protein MANES_05G130100 [Manihot esculenta] 86 3e-17 >XP_017218431.1 PREDICTED: squamosa promoter-binding-like protein 14 isoform X2 [Daucus carota subsp. sativus] Length = 1081 Score = 92.0 bits (227), Expect = 2e-19 Identities = 41/43 (95%), Positives = 42/43 (97%) Frame = +1 Query: 1 RPYIHSMLAIAAVCVCVCLFFRGAPDIGLVAPFKWENLGYGSV 129 RPYIHSMLAIAAVCVCVCLF RGAPDIGLVAPFKWENLGYG+V Sbjct: 1039 RPYIHSMLAIAAVCVCVCLFLRGAPDIGLVAPFKWENLGYGAV 1081 >XP_017218430.1 PREDICTED: squamosa promoter-binding-like protein 14 isoform X1 [Daucus carota subsp. sativus] KZM89284.1 hypothetical protein DCAR_026359 [Daucus carota subsp. sativus] Length = 1085 Score = 92.0 bits (227), Expect = 2e-19 Identities = 41/43 (95%), Positives = 42/43 (97%) Frame = +1 Query: 1 RPYIHSMLAIAAVCVCVCLFFRGAPDIGLVAPFKWENLGYGSV 129 RPYIHSMLAIAAVCVCVCLF RGAPDIGLVAPFKWENLGYG+V Sbjct: 1043 RPYIHSMLAIAAVCVCVCLFLRGAPDIGLVAPFKWENLGYGAV 1085 >XP_017218515.1 PREDICTED: squamosa promoter-binding-like protein 14 [Daucus carota subsp. sativus] KZM89282.1 hypothetical protein DCAR_026357 [Daucus carota subsp. sativus] Length = 1085 Score = 92.0 bits (227), Expect = 2e-19 Identities = 41/43 (95%), Positives = 42/43 (97%) Frame = +1 Query: 1 RPYIHSMLAIAAVCVCVCLFFRGAPDIGLVAPFKWENLGYGSV 129 RPYIHSMLAIAAVCVCVCLF RGAPDIGLVAPFKWENLGYG+V Sbjct: 1043 RPYIHSMLAIAAVCVCVCLFLRGAPDIGLVAPFKWENLGYGAV 1085 >XP_011034772.1 PREDICTED: squamosa promoter-binding-like protein 14 isoform X2 [Populus euphratica] Length = 991 Score = 91.7 bits (226), Expect = 3e-19 Identities = 40/43 (93%), Positives = 42/43 (97%) Frame = +1 Query: 1 RPYIHSMLAIAAVCVCVCLFFRGAPDIGLVAPFKWENLGYGSV 129 RPYIHSMLAIAAVCVCVCLFFRGAPDIGLVAPFKWENL YG++ Sbjct: 949 RPYIHSMLAIAAVCVCVCLFFRGAPDIGLVAPFKWENLNYGTI 991 >XP_011034771.1 PREDICTED: squamosa promoter-binding-like protein 14 isoform X1 [Populus euphratica] Length = 1073 Score = 91.7 bits (226), Expect = 3e-19 Identities = 40/43 (93%), Positives = 42/43 (97%) Frame = +1 Query: 1 RPYIHSMLAIAAVCVCVCLFFRGAPDIGLVAPFKWENLGYGSV 129 RPYIHSMLAIAAVCVCVCLFFRGAPDIGLVAPFKWENL YG++ Sbjct: 1031 RPYIHSMLAIAAVCVCVCLFFRGAPDIGLVAPFKWENLNYGTI 1073 >XP_002301891.1 SPL1-Related3 family protein [Populus trichocarpa] EEE81164.1 SPL1-Related3 family protein [Populus trichocarpa] Length = 1044 Score = 91.3 bits (225), Expect = 5e-19 Identities = 39/43 (90%), Positives = 42/43 (97%) Frame = +1 Query: 1 RPYIHSMLAIAAVCVCVCLFFRGAPDIGLVAPFKWENLGYGSV 129 RPY+HSMLAIAAVCVCVCLFFRGAPDIGLVAPFKWENL YG++ Sbjct: 1002 RPYVHSMLAIAAVCVCVCLFFRGAPDIGLVAPFKWENLNYGTI 1044 >XP_008453037.1 PREDICTED: squamosa promoter-binding-like protein 14 [Cucumis melo] Length = 1026 Score = 90.5 bits (223), Expect = 9e-19 Identities = 39/43 (90%), Positives = 42/43 (97%) Frame = +1 Query: 1 RPYIHSMLAIAAVCVCVCLFFRGAPDIGLVAPFKWENLGYGSV 129 RPYIHSMLAIAAVCVCVCLF RG+PDIGLVAPFKWENLGYG++ Sbjct: 984 RPYIHSMLAIAAVCVCVCLFLRGSPDIGLVAPFKWENLGYGTI 1026 >XP_004145609.1 PREDICTED: squamosa promoter-binding-like protein 14 [Cucumis sativus] KGN55552.1 hypothetical protein Csa_4G664590 [Cucumis sativus] Length = 1031 Score = 90.5 bits (223), Expect = 9e-19 Identities = 39/43 (90%), Positives = 42/43 (97%) Frame = +1 Query: 1 RPYIHSMLAIAAVCVCVCLFFRGAPDIGLVAPFKWENLGYGSV 129 RPYIHSMLAIAAVCVCVCLF RG+PDIGLVAPFKWENLGYG++ Sbjct: 989 RPYIHSMLAIAAVCVCVCLFLRGSPDIGLVAPFKWENLGYGTI 1031 >ALF46641.1 SBP-like protein, partial [Chrysanthemum x morifolium] Length = 916 Score = 88.2 bits (217), Expect = 5e-18 Identities = 39/43 (90%), Positives = 41/43 (95%) Frame = +1 Query: 1 RPYIHSMLAIAAVCVCVCLFFRGAPDIGLVAPFKWENLGYGSV 129 RPYIHSMLAIAAVCVCVCLF RGAPDIGLVAPFKWENL +GS+ Sbjct: 874 RPYIHSMLAIAAVCVCVCLFLRGAPDIGLVAPFKWENLNFGSM 916 >KVI07573.1 Ankyrin repeat-containing protein [Cynara cardunculus var. scolymus] Length = 942 Score = 88.2 bits (217), Expect = 5e-18 Identities = 39/43 (90%), Positives = 41/43 (95%) Frame = +1 Query: 1 RPYIHSMLAIAAVCVCVCLFFRGAPDIGLVAPFKWENLGYGSV 129 RPYIHSMLAIAAVCVCVCLF RGAPDIGLVAPFKWENL +GS+ Sbjct: 900 RPYIHSMLAIAAVCVCVCLFLRGAPDIGLVAPFKWENLNFGSM 942 >XP_017188218.1 PREDICTED: squamosa promoter-binding-like protein 14 [Malus domestica] Length = 1038 Score = 88.2 bits (217), Expect = 6e-18 Identities = 38/43 (88%), Positives = 41/43 (95%) Frame = +1 Query: 1 RPYIHSMLAIAAVCVCVCLFFRGAPDIGLVAPFKWENLGYGSV 129 RP+IHSMLAIAAVCVCVCLF RG PDIGLVAPFKWENLGYG++ Sbjct: 996 RPFIHSMLAIAAVCVCVCLFLRGLPDIGLVAPFKWENLGYGTI 1038 >XP_011041129.1 PREDICTED: squamosa promoter-binding-like protein 14 [Populus euphratica] XP_011041130.1 PREDICTED: squamosa promoter-binding-like protein 14 [Populus euphratica] Length = 1072 Score = 88.2 bits (217), Expect = 6e-18 Identities = 37/43 (86%), Positives = 42/43 (97%) Frame = +1 Query: 1 RPYIHSMLAIAAVCVCVCLFFRGAPDIGLVAPFKWENLGYGSV 129 RPY+HSMLAIAAVCVCVCLFFRGAPDIGLV+PFKWENL +G++ Sbjct: 1030 RPYVHSMLAIAAVCVCVCLFFRGAPDIGLVSPFKWENLDFGTI 1072 >XP_009372667.1 PREDICTED: squamosa promoter-binding-like protein 14 [Pyrus x bretschneideri] Length = 1075 Score = 88.2 bits (217), Expect = 6e-18 Identities = 38/43 (88%), Positives = 41/43 (95%) Frame = +1 Query: 1 RPYIHSMLAIAAVCVCVCLFFRGAPDIGLVAPFKWENLGYGSV 129 RP+IHSMLAIAAVCVCVCLF RG PDIGLVAPFKWENLGYG++ Sbjct: 1033 RPFIHSMLAIAAVCVCVCLFLRGLPDIGLVAPFKWENLGYGTI 1075 >XP_002307005.2 hypothetical protein POPTR_0005s28010g [Populus trichocarpa] EEE94001.2 hypothetical protein POPTR_0005s28010g [Populus trichocarpa] Length = 1039 Score = 87.4 bits (215), Expect = 1e-17 Identities = 37/43 (86%), Positives = 42/43 (97%) Frame = +1 Query: 1 RPYIHSMLAIAAVCVCVCLFFRGAPDIGLVAPFKWENLGYGSV 129 RPY+HSMLAIAAVCVCVCLFFRGAP+IGLVAPFKWENL +G++ Sbjct: 997 RPYVHSMLAIAAVCVCVCLFFRGAPNIGLVAPFKWENLDFGTI 1039 >CBI40788.3 unnamed protein product, partial [Vitis vinifera] Length = 921 Score = 86.7 bits (213), Expect = 2e-17 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +1 Query: 1 RPYIHSMLAIAAVCVCVCLFFRGAPDIGLVAPFKWENLGYGS 126 RPYIHSMLAIAAVCVCVCLF RG+PDIGLVAPFKWENL YG+ Sbjct: 879 RPYIHSMLAIAAVCVCVCLFLRGSPDIGLVAPFKWENLDYGT 920 >XP_002273784.1 PREDICTED: squamosa promoter-binding-like protein 14 [Vitis vinifera] Length = 1070 Score = 86.7 bits (213), Expect = 2e-17 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +1 Query: 1 RPYIHSMLAIAAVCVCVCLFFRGAPDIGLVAPFKWENLGYGS 126 RPYIHSMLAIAAVCVCVCLF RG+PDIGLVAPFKWENL YG+ Sbjct: 1028 RPYIHSMLAIAAVCVCVCLFLRGSPDIGLVAPFKWENLDYGT 1069 >XP_002510746.1 PREDICTED: squamosa promoter-binding-like protein 14 [Ricinus communis] XP_015575485.1 PREDICTED: squamosa promoter-binding-like protein 14 [Ricinus communis] XP_015575489.1 PREDICTED: squamosa promoter-binding-like protein 14 [Ricinus communis] XP_015575492.1 PREDICTED: squamosa promoter-binding-like protein 14 [Ricinus communis] EEF52933.1 Squamosa promoter-binding protein, putative [Ricinus communis] Length = 1073 Score = 86.7 bits (213), Expect = 2e-17 Identities = 38/43 (88%), Positives = 40/43 (93%) Frame = +1 Query: 1 RPYIHSMLAIAAVCVCVCLFFRGAPDIGLVAPFKWENLGYGSV 129 RPYIHSMLAIAAVCVCVCLF RGAPDIGLVAPFKWE L YG++ Sbjct: 1031 RPYIHSMLAIAAVCVCVCLFLRGAPDIGLVAPFKWETLDYGTI 1073 >XP_015879984.1 PREDICTED: squamosa promoter-binding-like protein 14 [Ziziphus jujuba] XP_015867006.1 PREDICTED: squamosa promoter-binding-like protein 14 [Ziziphus jujuba] Length = 1059 Score = 86.3 bits (212), Expect = 3e-17 Identities = 37/43 (86%), Positives = 41/43 (95%) Frame = +1 Query: 1 RPYIHSMLAIAAVCVCVCLFFRGAPDIGLVAPFKWENLGYGSV 129 RPYIHSMLAIAAVCVCVCLF RG+PDIGLVAPFKWENL +G++ Sbjct: 1017 RPYIHSMLAIAAVCVCVCLFLRGSPDIGLVAPFKWENLDFGTI 1059 >XP_012073540.1 PREDICTED: squamosa promoter-binding-like protein 14 [Jatropha curcas] KDP36723.1 hypothetical protein JCGZ_08014 [Jatropha curcas] Length = 1068 Score = 86.3 bits (212), Expect = 3e-17 Identities = 37/43 (86%), Positives = 40/43 (93%) Frame = +1 Query: 1 RPYIHSMLAIAAVCVCVCLFFRGAPDIGLVAPFKWENLGYGSV 129 RPY+HSMLAIAAVCVCVCLF RGAPDIGLVAPFKWE L YG++ Sbjct: 1026 RPYVHSMLAIAAVCVCVCLFLRGAPDIGLVAPFKWETLDYGTI 1068 >OAY50366.1 hypothetical protein MANES_05G130100 [Manihot esculenta] Length = 1074 Score = 86.3 bits (212), Expect = 3e-17 Identities = 37/43 (86%), Positives = 40/43 (93%) Frame = +1 Query: 1 RPYIHSMLAIAAVCVCVCLFFRGAPDIGLVAPFKWENLGYGSV 129 RPY+HSMLAIAAVCVCVCLF RGAPDIGLVAPFKWE L YG++ Sbjct: 1032 RPYVHSMLAIAAVCVCVCLFLRGAPDIGLVAPFKWETLDYGTI 1074