BLASTX nr result
ID: Panax25_contig00001016
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00001016 (427 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KZN03639.1 hypothetical protein DCAR_012395 [Daucus carota subsp... 64 5e-09 >KZN03639.1 hypothetical protein DCAR_012395 [Daucus carota subsp. sativus] Length = 995 Score = 63.5 bits (153), Expect = 5e-09 Identities = 28/45 (62%), Positives = 33/45 (73%), Gaps = 1/45 (2%) Frame = +1 Query: 292 FIILDYGNS-TWKWHQGSWITVVKRNMWILNWVISGTFADRRQGP 423 F++ Y + TW WHQG WI+V KRN WILNWV+ GTFAD QGP Sbjct: 913 FLVFLYNETHTWNWHQGYWISV-KRNNWILNWVVFGTFADHGQGP 956