BLASTX nr result
ID: Panax25_contig00000648
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00000648 (356 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017256827.1 PREDICTED: early light-induced protein 1, chlorop... 68 1e-11 XP_017225731.1 PREDICTED: early light-induced protein 1, chlorop... 61 3e-09 >XP_017256827.1 PREDICTED: early light-induced protein 1, chloroplastic-like [Daucus carota subsp. sativus] KZN09710.1 hypothetical protein DCAR_002366 [Daucus carota subsp. sativus] Length = 198 Score = 68.2 bits (165), Expect = 1e-11 Identities = 36/63 (57%), Positives = 48/63 (76%) Frame = +1 Query: 163 MAMSAVMQTIPASPVTRVIMNGSRLNLLPSSSSYAPRLPRSAASLRVRCMAEEIPKEESS 342 MA S+VMQ+ ASPVTR I G +LN++P+ ++ P L R +ASLR++CMAE+ KEESS Sbjct: 1 MASSSVMQSTLASPVTRGI-TGRKLNIVPAKCAFMPSLSRRSASLRLKCMAEDGQKEESS 59 Query: 343 PVT 351 PVT Sbjct: 60 PVT 62 >XP_017225731.1 PREDICTED: early light-induced protein 1, chloroplastic-like [Daucus carota subsp. sativus] KZM83118.1 hypothetical protein DCAR_030687 [Daucus carota subsp. sativus] Length = 177 Score = 61.2 bits (147), Expect = 3e-09 Identities = 36/61 (59%), Positives = 44/61 (72%) Frame = +1 Query: 163 MAMSAVMQTIPASPVTRVIMNGSRLNLLPSSSSYAPRLPRSAASLRVRCMAEEIPKEESS 342 MA S VMQ+I ASP + I G R+NL+P++ YAP L RSA SLR RCMA++ KEESS Sbjct: 1 MATSTVMQSILASPASTAI-TGRRVNLVPAN--YAPSLSRSAYSLRTRCMAKDGRKEESS 57 Query: 343 P 345 P Sbjct: 58 P 58