BLASTX nr result
ID: Panax25_contig00000615
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00000615 (690 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017239001.1 PREDICTED: thioredoxin-like 1-1, chloroplastic [D... 67 1e-09 >XP_017239001.1 PREDICTED: thioredoxin-like 1-1, chloroplastic [Daucus carota subsp. sativus] KZN00917.1 hypothetical protein DCAR_009671 [Daucus carota subsp. sativus] Length = 294 Score = 67.4 bits (163), Expect = 1e-09 Identities = 39/90 (43%), Positives = 46/90 (51%) Frame = +3 Query: 6 PDRCSLSPTXXXXXXXXXXXXXXXXXSFTYKPKPEQLVAVPEQEEILTAPASASQGNXXX 185 PDRCSL PT SFTYK K EQ + VP QE+ILTA AS S N Sbjct: 205 PDRCSLGPTKGLEEKELAALAANKDLSFTYKQKTEQPMDVPGQEKILTASASVSNINSYP 264 Query: 186 XXXXXXXXQSKTPTITVEDTKDKTLVTSGR 275 QS T + ++DT + TL+TSGR Sbjct: 265 PLPLPRPLQSNTTSNAIKDTDNNTLITSGR 294