BLASTX nr result
ID: Panax25_contig00000233
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00000233 (392 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_011002426.1 PREDICTED: uncharacterized protein LOC105109411 [... 63 2e-10 KDO80473.1 hypothetical protein CISIN_1g004174mg [Citrus sinensis] 65 7e-10 KDO80472.1 hypothetical protein CISIN_1g004174mg [Citrus sinensis] 65 7e-10 KDO80468.1 hypothetical protein CISIN_1g004174mg [Citrus sinensis] 65 7e-10 XP_004290918.1 PREDICTED: probable receptor-like serine/threonin... 65 7e-10 OMO91237.1 hypothetical protein CCACVL1_07181 [Corchorus capsula... 65 7e-10 XP_018839076.1 PREDICTED: probable receptor-like serine/threonin... 65 7e-10 KDO80469.1 hypothetical protein CISIN_1g004174mg [Citrus sinensis] 65 7e-10 XP_015074101.1 PREDICTED: probable receptor-like serine/threonin... 65 7e-10 XP_006357335.1 PREDICTED: probable receptor-like serine/threonin... 65 7e-10 XP_004237363.1 PREDICTED: probable receptor-like serine/threonin... 65 7e-10 KDO80470.1 hypothetical protein CISIN_1g004174mg [Citrus sinensis] 65 7e-10 XP_006472861.1 PREDICTED: probable L-type lectin-domain containi... 65 7e-10 XP_006434295.1 hypothetical protein CICLE_v10000358mg [Citrus cl... 65 7e-10 XP_017981697.1 PREDICTED: probable receptor-like serine/threonin... 65 7e-10 EOY16450.1 Kinase protein with adenine nucleotide alpha hydrolas... 65 7e-10 XP_017623395.1 PREDICTED: probable receptor-like serine/threonin... 65 7e-10 XP_016553017.1 PREDICTED: probable receptor-like serine/threonin... 65 7e-10 XP_012463654.1 PREDICTED: probable receptor-like serine/threonin... 65 7e-10 XP_016728393.1 PREDICTED: probable receptor-like serine/threonin... 65 7e-10 >XP_011002426.1 PREDICTED: uncharacterized protein LOC105109411 [Populus euphratica] Length = 96 Score = 62.8 bits (151), Expect = 2e-10 Identities = 30/32 (93%), Positives = 32/32 (100%) Frame = -3 Query: 96 IVDRDGKSSLLSLVKAFDSVLAVYEGFCNLKQ 1 IVDR+GKSSLLSLVKAFD+VLAVYEGFCNLKQ Sbjct: 58 IVDREGKSSLLSLVKAFDNVLAVYEGFCNLKQ 89 >KDO80473.1 hypothetical protein CISIN_1g004174mg [Citrus sinensis] Length = 611 Score = 65.5 bits (158), Expect = 7e-10 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -3 Query: 96 IVDRDGKSSLLSLVKAFDSVLAVYEGFCNLKQ 1 IVDRDGKSSLLSLVKAFDSVLAVYEGFCNLKQ Sbjct: 58 IVDRDGKSSLLSLVKAFDSVLAVYEGFCNLKQ 89 >KDO80472.1 hypothetical protein CISIN_1g004174mg [Citrus sinensis] Length = 643 Score = 65.5 bits (158), Expect = 7e-10 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -3 Query: 96 IVDRDGKSSLLSLVKAFDSVLAVYEGFCNLKQ 1 IVDRDGKSSLLSLVKAFDSVLAVYEGFCNLKQ Sbjct: 58 IVDRDGKSSLLSLVKAFDSVLAVYEGFCNLKQ 89 >KDO80468.1 hypothetical protein CISIN_1g004174mg [Citrus sinensis] Length = 696 Score = 65.5 bits (158), Expect = 7e-10 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -3 Query: 96 IVDRDGKSSLLSLVKAFDSVLAVYEGFCNLKQ 1 IVDRDGKSSLLSLVKAFDSVLAVYEGFCNLKQ Sbjct: 58 IVDRDGKSSLLSLVKAFDSVLAVYEGFCNLKQ 89 >XP_004290918.1 PREDICTED: probable receptor-like serine/threonine-protein kinase At5g57670 [Fragaria vesca subsp. vesca] Length = 744 Score = 65.5 bits (158), Expect = 7e-10 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -3 Query: 96 IVDRDGKSSLLSLVKAFDSVLAVYEGFCNLKQ 1 IVDRDGKSSLLSLVKAFDSVLAVYEGFCNLKQ Sbjct: 58 IVDRDGKSSLLSLVKAFDSVLAVYEGFCNLKQ 89 >OMO91237.1 hypothetical protein CCACVL1_07181 [Corchorus capsularis] Length = 754 Score = 65.5 bits (158), Expect = 7e-10 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -3 Query: 96 IVDRDGKSSLLSLVKAFDSVLAVYEGFCNLKQ 1 IVDRDGKSSLLSLVKAFDSVLAVYEGFCNLKQ Sbjct: 59 IVDRDGKSSLLSLVKAFDSVLAVYEGFCNLKQ 90 >XP_018839076.1 PREDICTED: probable receptor-like serine/threonine-protein kinase At5g57670 [Juglans regia] Length = 759 Score = 65.5 bits (158), Expect = 7e-10 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -3 Query: 96 IVDRDGKSSLLSLVKAFDSVLAVYEGFCNLKQ 1 IVDRDGKSSLLSLVKAFDSVLAVYEGFCNLKQ Sbjct: 62 IVDRDGKSSLLSLVKAFDSVLAVYEGFCNLKQ 93 >KDO80469.1 hypothetical protein CISIN_1g004174mg [Citrus sinensis] Length = 766 Score = 65.5 bits (158), Expect = 7e-10 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -3 Query: 96 IVDRDGKSSLLSLVKAFDSVLAVYEGFCNLKQ 1 IVDRDGKSSLLSLVKAFDSVLAVYEGFCNLKQ Sbjct: 58 IVDRDGKSSLLSLVKAFDSVLAVYEGFCNLKQ 89 >XP_015074101.1 PREDICTED: probable receptor-like serine/threonine-protein kinase At5g57670 [Solanum pennellii] Length = 769 Score = 65.5 bits (158), Expect = 7e-10 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -3 Query: 96 IVDRDGKSSLLSLVKAFDSVLAVYEGFCNLKQ 1 IVDRDGKSSLLSLVKAFDSVLAVYEGFCNLKQ Sbjct: 57 IVDRDGKSSLLSLVKAFDSVLAVYEGFCNLKQ 88 >XP_006357335.1 PREDICTED: probable receptor-like serine/threonine-protein kinase At5g57670 [Solanum tuberosum] Length = 769 Score = 65.5 bits (158), Expect = 7e-10 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -3 Query: 96 IVDRDGKSSLLSLVKAFDSVLAVYEGFCNLKQ 1 IVDRDGKSSLLSLVKAFDSVLAVYEGFCNLKQ Sbjct: 57 IVDRDGKSSLLSLVKAFDSVLAVYEGFCNLKQ 88 >XP_004237363.1 PREDICTED: probable receptor-like serine/threonine-protein kinase At5g57670 [Solanum lycopersicum] Length = 769 Score = 65.5 bits (158), Expect = 7e-10 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -3 Query: 96 IVDRDGKSSLLSLVKAFDSVLAVYEGFCNLKQ 1 IVDRDGKSSLLSLVKAFDSVLAVYEGFCNLKQ Sbjct: 57 IVDRDGKSSLLSLVKAFDSVLAVYEGFCNLKQ 88 >KDO80470.1 hypothetical protein CISIN_1g004174mg [Citrus sinensis] Length = 770 Score = 65.5 bits (158), Expect = 7e-10 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -3 Query: 96 IVDRDGKSSLLSLVKAFDSVLAVYEGFCNLKQ 1 IVDRDGKSSLLSLVKAFDSVLAVYEGFCNLKQ Sbjct: 58 IVDRDGKSSLLSLVKAFDSVLAVYEGFCNLKQ 89 >XP_006472861.1 PREDICTED: probable L-type lectin-domain containing receptor kinase II.1 [Citrus sinensis] Length = 770 Score = 65.5 bits (158), Expect = 7e-10 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -3 Query: 96 IVDRDGKSSLLSLVKAFDSVLAVYEGFCNLKQ 1 IVDRDGKSSLLSLVKAFDSVLAVYEGFCNLKQ Sbjct: 58 IVDRDGKSSLLSLVKAFDSVLAVYEGFCNLKQ 89 >XP_006434295.1 hypothetical protein CICLE_v10000358mg [Citrus clementina] ESR47535.1 hypothetical protein CICLE_v10000358mg [Citrus clementina] Length = 770 Score = 65.5 bits (158), Expect = 7e-10 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -3 Query: 96 IVDRDGKSSLLSLVKAFDSVLAVYEGFCNLKQ 1 IVDRDGKSSLLSLVKAFDSVLAVYEGFCNLKQ Sbjct: 58 IVDRDGKSSLLSLVKAFDSVLAVYEGFCNLKQ 89 >XP_017981697.1 PREDICTED: probable receptor-like serine/threonine-protein kinase At5g57670 [Theobroma cacao] Length = 771 Score = 65.5 bits (158), Expect = 7e-10 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -3 Query: 96 IVDRDGKSSLLSLVKAFDSVLAVYEGFCNLKQ 1 IVDRDGKSSLLSLVKAFDSVLAVYEGFCNLKQ Sbjct: 61 IVDRDGKSSLLSLVKAFDSVLAVYEGFCNLKQ 92 >EOY16450.1 Kinase protein with adenine nucleotide alpha hydrolases-like domain [Theobroma cacao] Length = 771 Score = 65.5 bits (158), Expect = 7e-10 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -3 Query: 96 IVDRDGKSSLLSLVKAFDSVLAVYEGFCNLKQ 1 IVDRDGKSSLLSLVKAFDSVLAVYEGFCNLKQ Sbjct: 61 IVDRDGKSSLLSLVKAFDSVLAVYEGFCNLKQ 92 >XP_017623395.1 PREDICTED: probable receptor-like serine/threonine-protein kinase At5g57670 isoform X2 [Gossypium arboreum] KHG01419.1 Putative proline-rich receptor-like protein kinase PERK11 [Gossypium arboreum] Length = 772 Score = 65.5 bits (158), Expect = 7e-10 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -3 Query: 96 IVDRDGKSSLLSLVKAFDSVLAVYEGFCNLKQ 1 IVDRDGKSSLLSLVKAFDSVLAVYEGFCNLKQ Sbjct: 65 IVDRDGKSSLLSLVKAFDSVLAVYEGFCNLKQ 96 >XP_016553017.1 PREDICTED: probable receptor-like serine/threonine-protein kinase At5g57670 isoform X2 [Capsicum annuum] Length = 773 Score = 65.5 bits (158), Expect = 7e-10 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -3 Query: 96 IVDRDGKSSLLSLVKAFDSVLAVYEGFCNLKQ 1 IVDRDGKSSLLSLVKAFDSVLAVYEGFCNLKQ Sbjct: 61 IVDRDGKSSLLSLVKAFDSVLAVYEGFCNLKQ 92 >XP_012463654.1 PREDICTED: probable receptor-like serine/threonine-protein kinase At5g57670 isoform X2 [Gossypium raimondii] KJB80638.1 hypothetical protein B456_013G108200 [Gossypium raimondii] Length = 775 Score = 65.5 bits (158), Expect = 7e-10 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -3 Query: 96 IVDRDGKSSLLSLVKAFDSVLAVYEGFCNLKQ 1 IVDRDGKSSLLSLVKAFDSVLAVYEGFCNLKQ Sbjct: 67 IVDRDGKSSLLSLVKAFDSVLAVYEGFCNLKQ 98 >XP_016728393.1 PREDICTED: probable receptor-like serine/threonine-protein kinase At5g57670 isoform X2 [Gossypium hirsutum] Length = 776 Score = 65.5 bits (158), Expect = 7e-10 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -3 Query: 96 IVDRDGKSSLLSLVKAFDSVLAVYEGFCNLKQ 1 IVDRDGKSSLLSLVKAFDSVLAVYEGFCNLKQ Sbjct: 69 IVDRDGKSSLLSLVKAFDSVLAVYEGFCNLKQ 100