BLASTX nr result
ID: Panax24_contig00042099
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00042099 (468 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_018381210.1 hypothetical protein CC77DRAFT_1053921, partial [... 123 6e-34 >XP_018381210.1 hypothetical protein CC77DRAFT_1053921, partial [Alternaria alternata] OAG15789.1 hypothetical protein CC77DRAFT_1053921, partial [Alternaria alternata] Length = 91 Score = 123 bits (309), Expect = 6e-34 Identities = 58/58 (100%), Positives = 58/58 (100%) Frame = +1 Query: 10 SISRRPSFLFLFITQTRNFVISRPNKYNSTVYNPLVRPLKPTRSAQTHTPKCLPPQTP 183 SISRRPSFLFLFITQTRNFVISRPNKYNSTVYNPLVRPLKPTRSAQTHTPKCLPPQTP Sbjct: 1 SISRRPSFLFLFITQTRNFVISRPNKYNSTVYNPLVRPLKPTRSAQTHTPKCLPPQTP 58