BLASTX nr result
ID: Panax24_contig00042010
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00042010 (414 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KNG52035.1 dna damage-inducible protein 1 [Stemphylium lycopersici] 97 9e-21 XP_003306147.1 hypothetical protein PTT_19187 [Pyrenophora teres... 64 4e-09 XP_001941584.1 UBA domain containing protein Mud1 [Pyrenophora t... 63 7e-09 Q0U3Y6.2 RecName: Full=DNA damage-inducible protein 1 62 1e-08 XP_001803736.1 hypothetical protein SNOG_13528 [Parastagonospora... 62 1e-08 XP_003653336.1 hypothetical protein THITE_107180 [Thielavia terr... 54 1e-06 Q2H085.2 RecName: Full=DNA damage-inducible protein 1 55 5e-06 XP_001224025.1 hypothetical protein CHGG_04811 [Chaetomium globo... 55 5e-06 >KNG52035.1 dna damage-inducible protein 1 [Stemphylium lycopersici] Length = 493 Score = 96.7 bits (239), Expect = 9e-21 Identities = 44/49 (89%), Positives = 48/49 (97%) Frame = -3 Query: 412 PAPSAPNSNFPREHVQQLTGMFGCSEQEAIQALEMFGGNVEHAASFLIG 266 PAP+A NS+FPREH+QQLTGMFGCSEQEAIQALEMFGGNVEHAASFL+G Sbjct: 444 PAPAASNSSFPREHIQQLTGMFGCSEQEAIQALEMFGGNVEHAASFLLG 492 >XP_003306147.1 hypothetical protein PTT_19187 [Pyrenophora teres f. teres 0-1] EFQ85765.1 hypothetical protein PTT_19187 [Pyrenophora teres f. teres 0-1] Length = 465 Score = 63.5 bits (153), Expect = 4e-09 Identities = 30/49 (61%), Positives = 36/49 (73%) Frame = -3 Query: 412 PAPSAPNSNFPREHVQQLTGMFGCSEQEAIQALEMFGGNVEHAASFLIG 266 P S P +FPREH+QQL MF CSE A QAL+M+GG+VE AA FL+G Sbjct: 416 PVSSPPPRSFPREHIQQLMSMFHCSELVARQALDMYGGDVELAAGFLLG 464 >XP_001941584.1 UBA domain containing protein Mud1 [Pyrenophora tritici-repentis Pt-1C-BFP] EDU44303.1 UBA domain containing protein Mud1 [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 453 Score = 62.8 bits (151), Expect = 7e-09 Identities = 36/72 (50%), Positives = 44/72 (61%) Frame = -3 Query: 412 PAPSAPNSNFPREHVQQLTGMFGCSEQEAIQALEMFGGNVEHAASFLIG*CMREHQDMLS 233 P S NFPREHVQQL MF CSE A QALEM+GG+VE AA FL+ + E Sbjct: 366 PLSSPTPLNFPREHVQQLMSMFHCSELAARQALEMYGGDVELAAGFLLE-SIDEDDPAQF 424 Query: 232 IATRRLPAFAYD 197 + TRR A+ ++ Sbjct: 425 LITRRYSAWLHE 436 >Q0U3Y6.2 RecName: Full=DNA damage-inducible protein 1 Length = 442 Score = 62.0 bits (149), Expect = 1e-08 Identities = 31/53 (58%), Positives = 37/53 (69%), Gaps = 4/53 (7%) Frame = -3 Query: 412 PAPSAPN----SNFPREHVQQLTGMFGCSEQEAIQALEMFGGNVEHAASFLIG 266 PAPSAP S+FP EH+ QL MFG + QEAIQALE+ GNV+ AAS +G Sbjct: 390 PAPSAPGPSTASSFPEEHINQLMSMFGVARQEAIQALEIASGNVDEAASVFLG 442 >XP_001803736.1 hypothetical protein SNOG_13528 [Parastagonospora nodorum SN15] EAT78975.2 hypothetical protein SNOG_13528 [Parastagonospora nodorum SN15] Length = 529 Score = 62.0 bits (149), Expect = 1e-08 Identities = 31/53 (58%), Positives = 37/53 (69%), Gaps = 4/53 (7%) Frame = -3 Query: 412 PAPSAPN----SNFPREHVQQLTGMFGCSEQEAIQALEMFGGNVEHAASFLIG 266 PAPSAP S+FP EH+ QL MFG + QEAIQALE+ GNV+ AAS +G Sbjct: 477 PAPSAPGPSTASSFPEEHINQLMSMFGVARQEAIQALEIASGNVDEAASVFLG 529 >XP_003653336.1 hypothetical protein THITE_107180 [Thielavia terrestris NRRL 8126] AEO67000.1 hypothetical protein THITE_107180 [Thielavia terrestris NRRL 8126] Length = 124 Score = 53.9 bits (128), Expect = 1e-06 Identities = 28/47 (59%), Positives = 35/47 (74%), Gaps = 1/47 (2%) Frame = -3 Query: 409 APSAPNSN-FPREHVQQLTGMFGCSEQEAIQALEMFGGNVEHAASFL 272 AP AP + FPREH++QL + G SEQ A+QALE GGNVE+AAS + Sbjct: 76 APPAPQRHTFPREHIEQLMAL-GASEQRAVQALEATGGNVEYAASLI 121 >Q2H085.2 RecName: Full=DNA damage-inducible protein 1 Length = 444 Score = 54.7 bits (130), Expect = 5e-06 Identities = 29/46 (63%), Positives = 35/46 (76%) Frame = -3 Query: 409 APSAPNSNFPREHVQQLTGMFGCSEQEAIQALEMFGGNVEHAASFL 272 AP+AP+ FPREH+ QL + G SEQ AIQALE GGNVE+AAS + Sbjct: 399 APAAPS--FPREHIDQLVAL-GASEQRAIQALEATGGNVEYAASLI 441 >XP_001224025.1 hypothetical protein CHGG_04811 [Chaetomium globosum CBS 148.51] EAQ88192.1 hypothetical protein CHGG_04811 [Chaetomium globosum CBS 148.51] Length = 494 Score = 54.7 bits (130), Expect = 5e-06 Identities = 29/46 (63%), Positives = 35/46 (76%) Frame = -3 Query: 409 APSAPNSNFPREHVQQLTGMFGCSEQEAIQALEMFGGNVEHAASFL 272 AP+AP+ FPREH+ QL + G SEQ AIQALE GGNVE+AAS + Sbjct: 449 APAAPS--FPREHIDQLVAL-GASEQRAIQALEATGGNVEYAASLI 491