BLASTX nr result
ID: Panax24_contig00041760
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00041760 (452 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CCF35318.1 hypothetical protein CH063_07131 [Colletotrichum higg... 57 5e-08 >CCF35318.1 hypothetical protein CH063_07131 [Colletotrichum higginsianum] Length = 73 Score = 56.6 bits (135), Expect = 5e-08 Identities = 26/37 (70%), Positives = 29/37 (78%) Frame = +2 Query: 137 SLEQTGASLDAQAAACAHQDSYDICRSNCSPLAPSFA 247 +LEQ GA L AQ A C ++DSYDICR NCSPLAP FA Sbjct: 26 ALEQAGAVLVAQQADCKNRDSYDICRRNCSPLAPGFA 62