BLASTX nr result
ID: Panax24_contig00041712
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00041712 (578 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_018385813.1 hypothetical protein CC77DRAFT_122843 [Alternaria... 66 2e-09 XP_001940217.1 conserved hypothetical protein [Pyrenophora triti... 65 5e-09 XP_003305457.1 hypothetical protein PTT_18307 [Pyrenophora teres... 65 5e-09 KNG45457.1 hypothetical protein TW65_07707 [Stemphylium lycopers... 61 1e-07 XP_008022337.1 hypothetical protein SETTUDRAFT_102969 [Setosphae... 59 1e-06 >XP_018385813.1 hypothetical protein CC77DRAFT_122843 [Alternaria alternata] OAG20392.1 hypothetical protein CC77DRAFT_122843 [Alternaria alternata] Length = 551 Score = 66.2 bits (160), Expect = 2e-09 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -3 Query: 576 GLVDIRPEENGQRRGMPKLVLTSAEKRKSTVF 481 GLVDIRPEENGQRRGMPKLVLTSAEKRKSTVF Sbjct: 520 GLVDIRPEENGQRRGMPKLVLTSAEKRKSTVF 551 >XP_001940217.1 conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] EDU42936.1 conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 543 Score = 65.1 bits (157), Expect = 5e-09 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = -3 Query: 576 GLVDIRPEENGQRRGMPKLVLTSAEKRKSTVF 481 GLVDIRPEENGQRRGMPKLVLTSAEKRK+TVF Sbjct: 512 GLVDIRPEENGQRRGMPKLVLTSAEKRKNTVF 543 >XP_003305457.1 hypothetical protein PTT_18307 [Pyrenophora teres f. teres 0-1] EFQ86442.1 hypothetical protein PTT_18307 [Pyrenophora teres f. teres 0-1] Length = 546 Score = 65.1 bits (157), Expect = 5e-09 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = -3 Query: 576 GLVDIRPEENGQRRGMPKLVLTSAEKRKSTVF 481 GLVDIRPEENGQRRGMPKLVLTSAEKRK+TVF Sbjct: 515 GLVDIRPEENGQRRGMPKLVLTSAEKRKNTVF 546 >KNG45457.1 hypothetical protein TW65_07707 [Stemphylium lycopersici] Length = 560 Score = 61.2 bits (147), Expect = 1e-07 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = -3 Query: 576 GLVDIRPEENGQRRGMPKLVLTSAEKRKSTVF 481 GLVDIRPEE GQRRGMPKL+LTS EKRKSTVF Sbjct: 529 GLVDIRPEEAGQRRGMPKLILTSTEKRKSTVF 560 >XP_008022337.1 hypothetical protein SETTUDRAFT_102969 [Setosphaeria turcica Et28A] EOA90514.1 hypothetical protein SETTUDRAFT_102969 [Setosphaeria turcica Et28A] Length = 558 Score = 58.5 bits (140), Expect = 1e-06 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = -3 Query: 576 GLVDIRPEENGQRRGMPKLVLTSAEKRKSTVF 481 GLVDIRPEENGQRR MPKL+LTS EKRKS V+ Sbjct: 527 GLVDIRPEENGQRRAMPKLILTSTEKRKSPVY 558