BLASTX nr result
ID: Panax24_contig00041469
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00041469 (418 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KZN05863.1 hypothetical protein DCAR_006700 [Daucus carota subsp... 82 2e-15 XP_017236283.1 PREDICTED: probable receptor-like protein kinase ... 82 2e-15 KZV40175.1 hypothetical protein F511_39553 [Dorcoceras hygrometr... 67 2e-10 XP_016647446.1 PREDICTED: probable receptor-like protein kinase ... 62 3e-10 XP_017970881.1 PREDICTED: probable receptor-like protein kinase ... 65 1e-09 EOX98077.1 Kinase superfamily protein isoform 2 [Theobroma cacao] 65 1e-09 EOX98076.1 Kinase superfamily protein isoform 1 [Theobroma cacao] 65 1e-09 XP_009348357.1 PREDICTED: probable receptor-like protein kinase ... 61 1e-09 XP_016539080.1 PREDICTED: probable receptor-like protein kinase ... 64 3e-09 XP_006349372.1 PREDICTED: probable receptor-like protein kinase ... 64 5e-09 XP_004230487.1 PREDICTED: probable receptor-like protein kinase ... 64 5e-09 KCW57084.1 hypothetical protein EUGRSUZ_I027341, partial [Eucaly... 63 6e-09 KCW57081.1 hypothetical protein EUGRSUZ_I02731, partial [Eucalyp... 63 6e-09 XP_011092345.1 PREDICTED: probable receptor-like protein kinase ... 63 6e-09 KCW57082.1 hypothetical protein EUGRSUZ_I02732, partial [Eucalyp... 63 6e-09 XP_018718058.1 PREDICTED: probable receptor-like protein kinase ... 63 6e-09 OMP01555.1 hypothetical protein COLO4_11780 [Corchorus olitorius] 63 6e-09 OMO74260.1 hypothetical protein CCACVL1_16878 [Corchorus capsula... 63 6e-09 XP_018718556.1 PREDICTED: probable receptor-like protein kinase ... 63 6e-09 KVI01795.1 Concanavalin A-like lectin/glucanase, subgroup [Cynar... 62 1e-08 >KZN05863.1 hypothetical protein DCAR_006700 [Daucus carota subsp. sativus] Length = 639 Score = 81.6 bits (200), Expect = 2e-15 Identities = 37/44 (84%), Positives = 41/44 (93%) Frame = +1 Query: 1 AHVMVALRPTILDALKMLEGDIEVPGIPDRPFYAVEYGRFSTLP 132 AHVMVALRPTILDALKMLEGD+E+P IPDRP+YAVEY + STLP Sbjct: 590 AHVMVALRPTILDALKMLEGDVEIPAIPDRPYYAVEYTKISTLP 633 >XP_017236283.1 PREDICTED: probable receptor-like protein kinase At1g11050 [Daucus carota subsp. sativus] Length = 786 Score = 81.6 bits (200), Expect = 2e-15 Identities = 37/44 (84%), Positives = 41/44 (93%) Frame = +1 Query: 1 AHVMVALRPTILDALKMLEGDIEVPGIPDRPFYAVEYGRFSTLP 132 AHVMVALRPTILDALKMLEGD+E+P IPDRP+YAVEY + STLP Sbjct: 590 AHVMVALRPTILDALKMLEGDVEIPAIPDRPYYAVEYTKISTLP 633 >KZV40175.1 hypothetical protein F511_39553 [Dorcoceras hygrometricum] Length = 523 Score = 67.4 bits (163), Expect = 2e-10 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = +1 Query: 1 AHVMVALRPTILDALKMLEGDIEVPGIPDRPFYA 102 AH+MVALRPTILDALKMLEGDIEVP IPDRPFYA Sbjct: 476 AHLMVALRPTILDALKMLEGDIEVPVIPDRPFYA 509 >XP_016647446.1 PREDICTED: probable receptor-like protein kinase At1g11050 [Prunus mume] Length = 83 Score = 62.4 bits (150), Expect = 3e-10 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +1 Query: 1 AHVMVALRPTILDALKMLEGDIEVPGIPDRP 93 AHVMVALRPTILDALKMLEGDIEVP IPDRP Sbjct: 12 AHVMVALRPTILDALKMLEGDIEVPPIPDRP 42 >XP_017970881.1 PREDICTED: probable receptor-like protein kinase At1g11050 [Theobroma cacao] Length = 653 Score = 65.5 bits (158), Expect = 1e-09 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 1 AHVMVALRPTILDALKMLEGDIEVPGIPDRP 93 AHVMVALRPTILDALKMLEGDIEVPGIPDRP Sbjct: 590 AHVMVALRPTILDALKMLEGDIEVPGIPDRP 620 >EOX98077.1 Kinase superfamily protein isoform 2 [Theobroma cacao] Length = 659 Score = 65.5 bits (158), Expect = 1e-09 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 1 AHVMVALRPTILDALKMLEGDIEVPGIPDRP 93 AHVMVALRPTILDALKMLEGDIEVPGIPDRP Sbjct: 590 AHVMVALRPTILDALKMLEGDIEVPGIPDRP 620 >EOX98076.1 Kinase superfamily protein isoform 1 [Theobroma cacao] Length = 718 Score = 65.5 bits (158), Expect = 1e-09 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 1 AHVMVALRPTILDALKMLEGDIEVPGIPDRP 93 AHVMVALRPTILDALKMLEGDIEVPGIPDRP Sbjct: 590 AHVMVALRPTILDALKMLEGDIEVPGIPDRP 620 >XP_009348357.1 PREDICTED: probable receptor-like protein kinase At1g11050 [Pyrus x bretschneideri] Length = 81 Score = 60.8 bits (146), Expect = 1e-09 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = +1 Query: 1 AHVMVALRPTILDALKMLEGDIEVPGIPDRP 93 AHVMVALRPTIL+ALKMLEGDIEVP IPDRP Sbjct: 12 AHVMVALRPTILEALKMLEGDIEVPQIPDRP 42 >XP_016539080.1 PREDICTED: probable receptor-like protein kinase At1g11050 [Capsicum annuum] Length = 646 Score = 63.9 bits (154), Expect = 3e-09 Identities = 35/51 (68%), Positives = 36/51 (70%), Gaps = 7/51 (13%) Frame = +1 Query: 1 AHVMVALRPTILDALKMLEGDIEVPGIPDRP-------FYAVEYGRFSTLP 132 AHVMVALRPTILDALKMLEGDIEVP IPDRP FY + FS P Sbjct: 582 AHVMVALRPTILDALKMLEGDIEVPEIPDRPAPLGQPSFYNAKGNTFSISP 632 >XP_006349372.1 PREDICTED: probable receptor-like protein kinase At1g11050 [Solanum tuberosum] Length = 646 Score = 63.5 bits (153), Expect = 5e-09 Identities = 35/51 (68%), Positives = 35/51 (68%), Gaps = 7/51 (13%) Frame = +1 Query: 1 AHVMVALRPTILDALKMLEGDIEVPGIPDRP-------FYAVEYGRFSTLP 132 AHVMVALRPTILDALKMLEGDIEVP IPDRP FY FS P Sbjct: 582 AHVMVALRPTILDALKMLEGDIEVPEIPDRPAPLGQPSFYNASGNTFSISP 632 >XP_004230487.1 PREDICTED: probable receptor-like protein kinase At1g11050 [Solanum lycopersicum] Length = 646 Score = 63.5 bits (153), Expect = 5e-09 Identities = 35/51 (68%), Positives = 35/51 (68%), Gaps = 7/51 (13%) Frame = +1 Query: 1 AHVMVALRPTILDALKMLEGDIEVPGIPDRP-------FYAVEYGRFSTLP 132 AHVMVALRPTILDALKMLEGDIEVP IPDRP FY FS P Sbjct: 582 AHVMVALRPTILDALKMLEGDIEVPEIPDRPAPLGHPSFYNASGNTFSISP 632 >KCW57084.1 hypothetical protein EUGRSUZ_I027341, partial [Eucalyptus grandis] Length = 396 Score = 63.2 bits (152), Expect = 6e-09 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +1 Query: 1 AHVMVALRPTILDALKMLEGDIEVPGIPDRP 93 AHVMVALRPTILDALKMLEGDIEVP IPDRP Sbjct: 322 AHVMVALRPTILDALKMLEGDIEVPSIPDRP 352 >KCW57081.1 hypothetical protein EUGRSUZ_I02731, partial [Eucalyptus grandis] Length = 606 Score = 63.2 bits (152), Expect = 6e-09 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +1 Query: 1 AHVMVALRPTILDALKMLEGDIEVPGIPDRP 93 AHVMVALRPTILDALKMLEGDIEVP IPDRP Sbjct: 569 AHVMVALRPTILDALKMLEGDIEVPSIPDRP 599 >XP_011092345.1 PREDICTED: probable receptor-like protein kinase At1g11050 [Sesamum indicum] Length = 640 Score = 63.2 bits (152), Expect = 6e-09 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +1 Query: 1 AHVMVALRPTILDALKMLEGDIEVPGIPDRP 93 AHVMVALRPTILDALKMLEGDIEVP IPDRP Sbjct: 576 AHVMVALRPTILDALKMLEGDIEVPAIPDRP 606 >KCW57082.1 hypothetical protein EUGRSUZ_I02732, partial [Eucalyptus grandis] Length = 642 Score = 63.2 bits (152), Expect = 6e-09 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +1 Query: 1 AHVMVALRPTILDALKMLEGDIEVPGIPDRP 93 AHVMVALRPTILDALKMLEGDIEVP IPDRP Sbjct: 605 AHVMVALRPTILDALKMLEGDIEVPSIPDRP 635 >XP_018718058.1 PREDICTED: probable receptor-like protein kinase At1g11050 [Eucalyptus grandis] Length = 645 Score = 63.2 bits (152), Expect = 6e-09 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +1 Query: 1 AHVMVALRPTILDALKMLEGDIEVPGIPDRP 93 AHVMVALRPTILDALKMLEGDIEVP IPDRP Sbjct: 594 AHVMVALRPTILDALKMLEGDIEVPSIPDRP 624 >OMP01555.1 hypothetical protein COLO4_11780 [Corchorus olitorius] Length = 649 Score = 63.2 bits (152), Expect = 6e-09 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +1 Query: 1 AHVMVALRPTILDALKMLEGDIEVPGIPDRP 93 AHVMVALRPTILDALKMLEGDIEVP IPDRP Sbjct: 586 AHVMVALRPTILDALKMLEGDIEVPAIPDRP 616 >OMO74260.1 hypothetical protein CCACVL1_16878 [Corchorus capsularis] Length = 649 Score = 63.2 bits (152), Expect = 6e-09 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +1 Query: 1 AHVMVALRPTILDALKMLEGDIEVPGIPDRP 93 AHVMVALRPTILDALKMLEGDIEVP IPDRP Sbjct: 586 AHVMVALRPTILDALKMLEGDIEVPAIPDRP 616 >XP_018718556.1 PREDICTED: probable receptor-like protein kinase At1g11050 [Eucalyptus grandis] Length = 680 Score = 63.2 bits (152), Expect = 6e-09 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +1 Query: 1 AHVMVALRPTILDALKMLEGDIEVPGIPDRP 93 AHVMVALRPTILDALKMLEGDIEVP IPDRP Sbjct: 617 AHVMVALRPTILDALKMLEGDIEVPSIPDRP 647 >KVI01795.1 Concanavalin A-like lectin/glucanase, subgroup [Cynara cardunculus var. scolymus] KVI11764.1 hypothetical protein Ccrd_009810 [Cynara cardunculus var. scolymus] Length = 502 Score = 62.4 bits (150), Expect = 1e-08 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = +1 Query: 1 AHVMVALRPTILDALKMLEGDIEVPGIPDRP 93 AHVMVALRPTI+DALKMLEGDIEVP IPDRP Sbjct: 439 AHVMVALRPTIMDALKMLEGDIEVPAIPDRP 469