BLASTX nr result
ID: Panax24_contig00041253
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00041253 (462 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_002281549.1 PREDICTED: putative pentatricopeptide repeat-cont... 100 2e-21 EMT00054.1 hypothetical protein F775_02346 [Aegilops tauschii] 92 2e-21 XP_019179992.1 PREDICTED: putative pentatricopeptide repeat-cont... 99 4e-21 XP_011019687.1 PREDICTED: putative pentatricopeptide repeat-cont... 98 6e-21 XP_002309575.2 pentatricopeptide repeat-containing family protei... 98 6e-21 XP_010242822.1 PREDICTED: putative pentatricopeptide repeat-cont... 97 2e-20 KMT16913.1 hypothetical protein BVRB_2g043850 [Beta vulgaris sub... 96 3e-20 XP_017233693.1 PREDICTED: putative pentatricopeptide repeat-cont... 96 3e-20 CDP18486.1 unnamed protein product [Coffea canephora] 96 3e-20 XP_019103629.1 PREDICTED: putative pentatricopeptide repeat-cont... 96 3e-20 XP_015080980.1 PREDICTED: putative pentatricopeptide repeat-cont... 96 4e-20 XP_006367759.1 PREDICTED: putative pentatricopeptide repeat-cont... 96 4e-20 XP_010323251.1 PREDICTED: putative pentatricopeptide repeat-cont... 96 4e-20 KNA11786.1 hypothetical protein SOVF_131920 [Spinacia oleracea] 96 4e-20 OAY26724.1 hypothetical protein MANES_16G069700 [Manihot esculenta] 96 5e-20 XP_012077465.1 PREDICTED: putative pentatricopeptide repeat-cont... 95 7e-20 EMT00270.1 hypothetical protein F775_21848 [Aegilops tauschii] 92 8e-20 GAV78346.1 LOW QUALITY PROTEIN: PPR domain-containing protein/PP... 95 8e-20 XP_016553132.1 PREDICTED: putative pentatricopeptide repeat-cont... 94 2e-19 XP_019233082.1 PREDICTED: putative pentatricopeptide repeat-cont... 94 2e-19 >XP_002281549.1 PREDICTED: putative pentatricopeptide repeat-containing protein At3g15130 [Vitis vinifera] CBI23662.3 unnamed protein product, partial [Vitis vinifera] Length = 685 Score = 99.8 bits (247), Expect = 2e-21 Identities = 44/47 (93%), Positives = 44/47 (93%) Frame = -2 Query: 461 FKNLRVCGDCHEFIKGLSKILVKVFVVRDANRFHRFEDGACSCKDYW 321 FKNLRVCGDCHEFIKGLSKIL KVFVVRDANRFHRFEDG CSC DYW Sbjct: 639 FKNLRVCGDCHEFIKGLSKILKKVFVVRDANRFHRFEDGLCSCGDYW 685 >EMT00054.1 hypothetical protein F775_02346 [Aegilops tauschii] Length = 113 Score = 92.4 bits (228), Expect = 2e-21 Identities = 37/47 (78%), Positives = 43/47 (91%) Frame = -2 Query: 461 FKNLRVCGDCHEFIKGLSKILVKVFVVRDANRFHRFEDGACSCKDYW 321 +KNLRVCGDCHEF KGLS+++ + VVRDANRFHRF+DGACSCKDYW Sbjct: 67 YKNLRVCGDCHEFFKGLSRVVGRAMVVRDANRFHRFQDGACSCKDYW 113 >XP_019179992.1 PREDICTED: putative pentatricopeptide repeat-containing protein At3g15130 [Ipomoea nil] Length = 694 Score = 98.6 bits (244), Expect = 4e-21 Identities = 42/47 (89%), Positives = 46/47 (97%) Frame = -2 Query: 461 FKNLRVCGDCHEFIKGLSKILVKVFVVRDANRFHRFEDGACSCKDYW 321 FKNLRVCGDCHEFIKGLSKIL KVF+VRDANRFH+FE+GACSC+DYW Sbjct: 648 FKNLRVCGDCHEFIKGLSKILNKVFLVRDANRFHKFENGACSCRDYW 694 >XP_011019687.1 PREDICTED: putative pentatricopeptide repeat-containing protein At3g15130 [Populus euphratica] Length = 689 Score = 98.2 bits (243), Expect = 6e-21 Identities = 43/47 (91%), Positives = 44/47 (93%) Frame = -2 Query: 461 FKNLRVCGDCHEFIKGLSKILVKVFVVRDANRFHRFEDGACSCKDYW 321 FKNLRVCGDCHEFIKGLSKIL VFVVRDANRFHRFEDG CSC+DYW Sbjct: 643 FKNLRVCGDCHEFIKGLSKILRVVFVVRDANRFHRFEDGLCSCRDYW 689 >XP_002309575.2 pentatricopeptide repeat-containing family protein [Populus trichocarpa] EEE93098.2 pentatricopeptide repeat-containing family protein [Populus trichocarpa] Length = 693 Score = 98.2 bits (243), Expect = 6e-21 Identities = 43/47 (91%), Positives = 44/47 (93%) Frame = -2 Query: 461 FKNLRVCGDCHEFIKGLSKILVKVFVVRDANRFHRFEDGACSCKDYW 321 FKNLRVCGDCHEFIKGLSKIL VFVVRDANRFHRFEDG CSC+DYW Sbjct: 647 FKNLRVCGDCHEFIKGLSKILRVVFVVRDANRFHRFEDGLCSCRDYW 693 >XP_010242822.1 PREDICTED: putative pentatricopeptide repeat-containing protein At3g15130 [Nelumbo nucifera] Length = 683 Score = 96.7 bits (239), Expect = 2e-20 Identities = 41/47 (87%), Positives = 43/47 (91%) Frame = -2 Query: 461 FKNLRVCGDCHEFIKGLSKILVKVFVVRDANRFHRFEDGACSCKDYW 321 FKNLRVCGDCHEF KGLSK+L +VFVVRDANRFHRFEDG CSC DYW Sbjct: 637 FKNLRVCGDCHEFFKGLSKVLKRVFVVRDANRFHRFEDGECSCGDYW 683 >KMT16913.1 hypothetical protein BVRB_2g043850 [Beta vulgaris subsp. vulgaris] Length = 668 Score = 96.3 bits (238), Expect = 3e-20 Identities = 40/47 (85%), Positives = 44/47 (93%) Frame = -2 Query: 461 FKNLRVCGDCHEFIKGLSKILVKVFVVRDANRFHRFEDGACSCKDYW 321 FKNLRVCGDCHEFIKGLSK+L +VFVVRDANRFH+F+DG CSC DYW Sbjct: 622 FKNLRVCGDCHEFIKGLSKVLKRVFVVRDANRFHKFQDGVCSCGDYW 668 >XP_017233693.1 PREDICTED: putative pentatricopeptide repeat-containing protein At3g15130 [Daucus carota subsp. sativus] Length = 692 Score = 96.3 bits (238), Expect = 3e-20 Identities = 41/47 (87%), Positives = 44/47 (93%) Frame = -2 Query: 461 FKNLRVCGDCHEFIKGLSKILVKVFVVRDANRFHRFEDGACSCKDYW 321 +KNLRVCGDCHEFIKGLSKIL KVFVVRDA+RFH+FEDG CSC DYW Sbjct: 646 YKNLRVCGDCHEFIKGLSKILSKVFVVRDASRFHKFEDGRCSCNDYW 692 >CDP18486.1 unnamed protein product [Coffea canephora] Length = 692 Score = 96.3 bits (238), Expect = 3e-20 Identities = 41/47 (87%), Positives = 44/47 (93%) Frame = -2 Query: 461 FKNLRVCGDCHEFIKGLSKILVKVFVVRDANRFHRFEDGACSCKDYW 321 FKNLRVCGDCHEFIKGLS IL KVF+VRDANRFH+FE+G CSCKDYW Sbjct: 646 FKNLRVCGDCHEFIKGLSMILCKVFLVRDANRFHKFENGICSCKDYW 692 >XP_019103629.1 PREDICTED: putative pentatricopeptide repeat-containing protein At3g15130 [Beta vulgaris subsp. vulgaris] XP_019103630.1 PREDICTED: putative pentatricopeptide repeat-containing protein At3g15130 [Beta vulgaris subsp. vulgaris] XP_019103631.1 PREDICTED: putative pentatricopeptide repeat-containing protein At3g15130 [Beta vulgaris subsp. vulgaris] XP_019103632.1 PREDICTED: putative pentatricopeptide repeat-containing protein At3g15130 [Beta vulgaris subsp. vulgaris] Length = 693 Score = 96.3 bits (238), Expect = 3e-20 Identities = 40/47 (85%), Positives = 44/47 (93%) Frame = -2 Query: 461 FKNLRVCGDCHEFIKGLSKILVKVFVVRDANRFHRFEDGACSCKDYW 321 FKNLRVCGDCHEFIKGLSK+L +VFVVRDANRFH+F+DG CSC DYW Sbjct: 647 FKNLRVCGDCHEFIKGLSKVLKRVFVVRDANRFHKFQDGVCSCGDYW 693 >XP_015080980.1 PREDICTED: putative pentatricopeptide repeat-containing protein At3g15130 [Solanum pennellii] XP_015080981.1 PREDICTED: putative pentatricopeptide repeat-containing protein At3g15130 [Solanum pennellii] XP_015080982.1 PREDICTED: putative pentatricopeptide repeat-containing protein At3g15130 [Solanum pennellii] XP_015080983.1 PREDICTED: putative pentatricopeptide repeat-containing protein At3g15130 [Solanum pennellii] XP_015080984.1 PREDICTED: putative pentatricopeptide repeat-containing protein At3g15130 [Solanum pennellii] Length = 693 Score = 95.9 bits (237), Expect = 4e-20 Identities = 39/47 (82%), Positives = 45/47 (95%) Frame = -2 Query: 461 FKNLRVCGDCHEFIKGLSKILVKVFVVRDANRFHRFEDGACSCKDYW 321 FKNLRVCGDCHE+IKGLSKIL K+F+VRDANRFH+FE+G CSC+DYW Sbjct: 647 FKNLRVCGDCHEYIKGLSKILKKIFLVRDANRFHKFENGTCSCRDYW 693 >XP_006367759.1 PREDICTED: putative pentatricopeptide repeat-containing protein At3g15130 [Solanum tuberosum] Length = 693 Score = 95.9 bits (237), Expect = 4e-20 Identities = 39/47 (82%), Positives = 45/47 (95%) Frame = -2 Query: 461 FKNLRVCGDCHEFIKGLSKILVKVFVVRDANRFHRFEDGACSCKDYW 321 FKNLRVCGDCHE+IKGLSKIL K+F+VRDANRFH+FE+G CSC+DYW Sbjct: 647 FKNLRVCGDCHEYIKGLSKILKKIFLVRDANRFHKFENGTCSCRDYW 693 >XP_010323251.1 PREDICTED: putative pentatricopeptide repeat-containing protein At3g15130 [Solanum lycopersicum] XP_010323254.1 PREDICTED: putative pentatricopeptide repeat-containing protein At3g15130 [Solanum lycopersicum] XP_010323255.1 PREDICTED: putative pentatricopeptide repeat-containing protein At3g15130 [Solanum lycopersicum] Length = 693 Score = 95.9 bits (237), Expect = 4e-20 Identities = 39/47 (82%), Positives = 45/47 (95%) Frame = -2 Query: 461 FKNLRVCGDCHEFIKGLSKILVKVFVVRDANRFHRFEDGACSCKDYW 321 FKNLRVCGDCHE+IKGLSKIL K+F+VRDANRFH+FE+G CSC+DYW Sbjct: 647 FKNLRVCGDCHEYIKGLSKILKKIFLVRDANRFHKFENGTCSCRDYW 693 >KNA11786.1 hypothetical protein SOVF_131920 [Spinacia oleracea] Length = 694 Score = 95.9 bits (237), Expect = 4e-20 Identities = 40/47 (85%), Positives = 44/47 (93%) Frame = -2 Query: 461 FKNLRVCGDCHEFIKGLSKILVKVFVVRDANRFHRFEDGACSCKDYW 321 FKNLRVCGDCHEFIKGLSK+L +VFVVRDANRFH+F+DG CSC DYW Sbjct: 648 FKNLRVCGDCHEFIKGLSKVLERVFVVRDANRFHKFKDGVCSCGDYW 694 >OAY26724.1 hypothetical protein MANES_16G069700 [Manihot esculenta] Length = 646 Score = 95.5 bits (236), Expect = 5e-20 Identities = 40/47 (85%), Positives = 44/47 (93%) Frame = -2 Query: 461 FKNLRVCGDCHEFIKGLSKILVKVFVVRDANRFHRFEDGACSCKDYW 321 FKNLR+CGDCH+FIKGLSKIL VFVVRDANRFHRFE+G CSC+DYW Sbjct: 600 FKNLRICGDCHQFIKGLSKILEMVFVVRDANRFHRFENGICSCRDYW 646 >XP_012077465.1 PREDICTED: putative pentatricopeptide repeat-containing protein At3g15130 [Jatropha curcas] KDP34228.1 hypothetical protein JCGZ_07799 [Jatropha curcas] Length = 689 Score = 95.1 bits (235), Expect = 7e-20 Identities = 42/47 (89%), Positives = 43/47 (91%) Frame = -2 Query: 461 FKNLRVCGDCHEFIKGLSKILVKVFVVRDANRFHRFEDGACSCKDYW 321 FKNLRVCGDCHEFIKGLSKIL VFVVRDANRFHRFE+G CSC DYW Sbjct: 643 FKNLRVCGDCHEFIKGLSKILKVVFVVRDANRFHRFENGLCSCGDYW 689 >EMT00270.1 hypothetical protein F775_21848 [Aegilops tauschii] Length = 279 Score = 92.4 bits (228), Expect = 8e-20 Identities = 37/47 (78%), Positives = 43/47 (91%) Frame = -2 Query: 461 FKNLRVCGDCHEFIKGLSKILVKVFVVRDANRFHRFEDGACSCKDYW 321 +KNLRVCGDCHEF KGLS+++ + VVRDANRFHRF+DGACSCKDYW Sbjct: 233 YKNLRVCGDCHEFFKGLSRVVGRAMVVRDANRFHRFQDGACSCKDYW 279 >GAV78346.1 LOW QUALITY PROTEIN: PPR domain-containing protein/PPR_2 domain-containing protein/DYW_deaminase domain-containing protein, partial [Cephalotus follicularis] Length = 544 Score = 94.7 bits (234), Expect = 8e-20 Identities = 41/47 (87%), Positives = 43/47 (91%) Frame = -2 Query: 461 FKNLRVCGDCHEFIKGLSKILVKVFVVRDANRFHRFEDGACSCKDYW 321 FKNLRVCGDCHEFIKGLSKIL VF+VRDANRFHRF+DG CSC DYW Sbjct: 498 FKNLRVCGDCHEFIKGLSKILKMVFLVRDANRFHRFKDGLCSCGDYW 544 >XP_016553132.1 PREDICTED: putative pentatricopeptide repeat-containing protein At3g15130 [Capsicum annuum] XP_016579849.1 PREDICTED: putative pentatricopeptide repeat-containing protein At3g15130 [Capsicum annuum] Length = 685 Score = 94.0 bits (232), Expect = 2e-19 Identities = 39/47 (82%), Positives = 43/47 (91%) Frame = -2 Query: 461 FKNLRVCGDCHEFIKGLSKILVKVFVVRDANRFHRFEDGACSCKDYW 321 FKNLRVCGDCHE+IKGLSKIL K F+VRDANRFH+FE+G CSCK YW Sbjct: 639 FKNLRVCGDCHEYIKGLSKILTKTFLVRDANRFHKFENGTCSCKGYW 685 >XP_019233082.1 PREDICTED: putative pentatricopeptide repeat-containing protein At3g15130 [Nicotiana attenuata] OIT27614.1 putative pentatricopeptide repeat-containing protein [Nicotiana attenuata] Length = 693 Score = 93.6 bits (231), Expect = 2e-19 Identities = 38/47 (80%), Positives = 44/47 (93%) Frame = -2 Query: 461 FKNLRVCGDCHEFIKGLSKILVKVFVVRDANRFHRFEDGACSCKDYW 321 FKNLRVCGDCHE+IKGLSKI K+ +VRDANRFH+FE+GACSC+DYW Sbjct: 647 FKNLRVCGDCHEYIKGLSKIFKKILLVRDANRFHKFENGACSCRDYW 693