BLASTX nr result
ID: Panax24_contig00040981
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00040981 (505 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_011079533.1 PREDICTED: stachyose synthase [Sesamum indicum] 59 3e-07 XP_011042279.1 PREDICTED: stachyose synthase [Populus euphratica] 59 4e-07 XP_006386712.1 hypothetical protein POPTR_0002s19450g [Populus t... 59 4e-07 EPS69400.1 stachyose synthase [Genlisea aurea] 59 6e-07 AMT81067.1 stachyose synthase, partial [Rehmannia glutinosa] 58 8e-07 JAU64294.1 putative galactinol--sucrose galactosyltransferase 4,... 55 1e-06 JAT58092.1 Stachyose synthase [Anthurium amnicola] 57 2e-06 JAT46999.1 Stachyose synthase [Anthurium amnicola] 57 2e-06 XP_010259226.1 PREDICTED: stachyose synthase [Nelumbo nucifera] 57 2e-06 XP_016539644.1 PREDICTED: stachyose synthase [Capsicum annuum] 57 2e-06 XP_004308391.1 PREDICTED: stachyose synthase-like [Fragaria vesc... 57 3e-06 XP_006396395.1 hypothetical protein EUTSA_v10028420mg [Eutrema s... 57 3e-06 JAU36885.1 putative galactinol--sucrose galactosyltransferase 4,... 55 3e-06 XP_018455570.1 PREDICTED: probable galactinol--sucrose galactosy... 56 4e-06 XP_011040990.1 PREDICTED: stachyose synthase-like [Populus euphr... 56 4e-06 XP_002320969.2 stachyose synthase family protein [Populus tricho... 56 4e-06 AAR31209.1 stachyose synthase, partial [Medicago sativa] 55 4e-06 CAC86963.1 stachyose synthase [Stachys affinis] 56 5e-06 XP_006287033.1 hypothetical protein CARUB_v10000180mg, partial [... 56 5e-06 KFK35650.1 hypothetical protein AALP_AA4G018400 [Arabis alpina] 55 7e-06 >XP_011079533.1 PREDICTED: stachyose synthase [Sesamum indicum] Length = 862 Score = 59.3 bits (142), Expect = 3e-07 Identities = 25/43 (58%), Positives = 32/43 (74%) Frame = -1 Query: 430 GAFKFQEAGWNPKEQIFEGYSNGYRSLLATVHAIDIDWDQRKE 302 GAF Q AGW+PKEQ +GYS Y+ L +VHA D++WDQ+KE Sbjct: 681 GAFNCQGAGWDPKEQRIKGYSQCYKPLSGSVHASDLEWDQKKE 723 >XP_011042279.1 PREDICTED: stachyose synthase [Populus euphratica] Length = 866 Score = 58.9 bits (141), Expect = 4e-07 Identities = 25/43 (58%), Positives = 31/43 (72%) Frame = -1 Query: 430 GAFKFQEAGWNPKEQIFEGYSNGYRSLLATVHAIDIDWDQRKE 302 GAF Q AGW+PKEQ +GYS Y+ L +VH DI+WDQ+KE Sbjct: 680 GAFNCQGAGWDPKEQRIKGYSECYKPLSVSVHVTDIEWDQKKE 722 >XP_006386712.1 hypothetical protein POPTR_0002s19450g [Populus trichocarpa] ERP64509.1 hypothetical protein POPTR_0002s19450g [Populus trichocarpa] Length = 866 Score = 58.9 bits (141), Expect = 4e-07 Identities = 25/43 (58%), Positives = 31/43 (72%) Frame = -1 Query: 430 GAFKFQEAGWNPKEQIFEGYSNGYRSLLATVHAIDIDWDQRKE 302 GAF Q AGW+PKEQ +GYS Y+ L +VH DI+WDQ+KE Sbjct: 680 GAFNCQGAGWDPKEQRIKGYSECYKPLSVSVHVTDIEWDQKKE 722 >EPS69400.1 stachyose synthase [Genlisea aurea] Length = 860 Score = 58.5 bits (140), Expect = 6e-07 Identities = 25/44 (56%), Positives = 33/44 (75%) Frame = -1 Query: 430 GAFKFQEAGWNPKEQIFEGYSNGYRSLLATVHAIDIDWDQRKET 299 GAF Q AGW+PKEQ +GYS Y+ L A+VH +I+WDQ++ET Sbjct: 677 GAFNCQGAGWDPKEQRIKGYSQCYKPLAASVHVDNIEWDQKQET 720 >AMT81067.1 stachyose synthase, partial [Rehmannia glutinosa] Length = 794 Score = 58.2 bits (139), Expect = 8e-07 Identities = 25/43 (58%), Positives = 31/43 (72%) Frame = -1 Query: 430 GAFKFQEAGWNPKEQIFEGYSNGYRSLLATVHAIDIDWDQRKE 302 GAF Q AGW+PKEQ +GYS Y+ L +VHA DI+WDQ+ E Sbjct: 686 GAFNCQGAGWDPKEQRIKGYSQCYKPLSGSVHATDIEWDQKTE 728 >JAU64294.1 putative galactinol--sucrose galactosyltransferase 4, partial [Noccaea caerulescens] Length = 129 Score = 55.1 bits (131), Expect = 1e-06 Identities = 23/43 (53%), Positives = 29/43 (67%) Frame = -1 Query: 430 GAFKFQEAGWNPKEQIFEGYSNGYRSLLATVHAIDIDWDQRKE 302 GAF Q AGW+PKE F+GY Y+++ TVH DI+WDQ E Sbjct: 66 GAFNCQGAGWSPKEHRFKGYKECYQTVSGTVHVSDIEWDQNPE 108 >JAT58092.1 Stachyose synthase [Anthurium amnicola] Length = 860 Score = 57.0 bits (136), Expect = 2e-06 Identities = 23/43 (53%), Positives = 31/43 (72%) Frame = -1 Query: 430 GAFKFQEAGWNPKEQIFEGYSNGYRSLLATVHAIDIDWDQRKE 302 GAF Q AGW+P+EQ GYS+ Y+ + VH +DI+WDQ+KE Sbjct: 677 GAFNCQGAGWDPEEQRIRGYSHCYKPVSGAVHVLDIEWDQKKE 719 >JAT46999.1 Stachyose synthase [Anthurium amnicola] Length = 860 Score = 57.0 bits (136), Expect = 2e-06 Identities = 23/43 (53%), Positives = 31/43 (72%) Frame = -1 Query: 430 GAFKFQEAGWNPKEQIFEGYSNGYRSLLATVHAIDIDWDQRKE 302 GAF Q AGW+P+EQ GYS+ Y+ + VH +DI+WDQ+KE Sbjct: 677 GAFNCQGAGWDPEEQRIRGYSHCYKPVSGAVHVLDIEWDQKKE 719 >XP_010259226.1 PREDICTED: stachyose synthase [Nelumbo nucifera] Length = 869 Score = 57.0 bits (136), Expect = 2e-06 Identities = 24/44 (54%), Positives = 31/44 (70%) Frame = -1 Query: 430 GAFKFQEAGWNPKEQIFEGYSNGYRSLLATVHAIDIDWDQRKET 299 GAF Q AGW+PKEQ +GYS Y+ + A+VH D++WDQ ET Sbjct: 684 GAFNCQGAGWDPKEQRIKGYSQCYKPISASVHVRDVEWDQTTET 727 >XP_016539644.1 PREDICTED: stachyose synthase [Capsicum annuum] Length = 884 Score = 57.0 bits (136), Expect = 2e-06 Identities = 24/43 (55%), Positives = 31/43 (72%) Frame = -1 Query: 430 GAFKFQEAGWNPKEQIFEGYSNGYRSLLATVHAIDIDWDQRKE 302 GAF Q AGW+PKE+ +GYSN Y+ + +VH DI+WDQ KE Sbjct: 693 GAFNCQGAGWDPKEKRIKGYSNCYKPMTGSVHVDDIEWDQLKE 735 >XP_004308391.1 PREDICTED: stachyose synthase-like [Fragaria vesca subsp. vesca] Length = 868 Score = 56.6 bits (135), Expect = 3e-06 Identities = 23/43 (53%), Positives = 31/43 (72%) Frame = -1 Query: 430 GAFKFQEAGWNPKEQIFEGYSNGYRSLLATVHAIDIDWDQRKE 302 GAF Q AGW+PKEQ +GYS Y+ +L +VH +I+WDQ+ E Sbjct: 682 GAFNCQGAGWDPKEQRIKGYSQCYKEILCSVHVSEIEWDQKME 724 >XP_006396395.1 hypothetical protein EUTSA_v10028420mg [Eutrema salsugineum] ESQ37848.1 hypothetical protein EUTSA_v10028420mg [Eutrema salsugineum] Length = 877 Score = 56.6 bits (135), Expect = 3e-06 Identities = 25/59 (42%), Positives = 36/59 (61%) Frame = -1 Query: 430 GAFKFQEAGWNPKEQIFEGYSNGYRSLLATVHAIDIDWDQRKETILCIGATRGEETMFK 254 GAF Q AGW+PKE F+GY + Y+++ TVH DI+WDQ E + G+ ++K Sbjct: 691 GAFNCQGAGWSPKEHRFKGYKDCYKTVSGTVHVSDIEWDQNPEAASSQVSYAGDYLVYK 749 >JAU36885.1 putative galactinol--sucrose galactosyltransferase 4, partial [Noccaea caerulescens] Length = 199 Score = 55.1 bits (131), Expect = 3e-06 Identities = 23/43 (53%), Positives = 29/43 (67%) Frame = -1 Query: 430 GAFKFQEAGWNPKEQIFEGYSNGYRSLLATVHAIDIDWDQRKE 302 GAF Q AGW+PKE F+GY Y+++ TVH DI+WDQ E Sbjct: 81 GAFNCQGAGWSPKEHRFKGYKECYQTVSGTVHVSDIEWDQNPE 123 >XP_018455570.1 PREDICTED: probable galactinol--sucrose galactosyltransferase 4, partial [Raphanus sativus] Length = 736 Score = 56.2 bits (134), Expect = 4e-06 Identities = 23/45 (51%), Positives = 29/45 (64%) Frame = -1 Query: 430 GAFKFQEAGWNPKEQIFEGYSNGYRSLLATVHAIDIDWDQRKETI 296 GAF Q AGW+PKE F+GY Y S+ T+H DI+WDQ E + Sbjct: 688 GAFNCQGAGWSPKEHRFKGYKECYMSVSGTIHVSDIEWDQNPEAV 732 >XP_011040990.1 PREDICTED: stachyose synthase-like [Populus euphratica] XP_011040998.1 PREDICTED: stachyose synthase-like [Populus euphratica] Length = 867 Score = 56.2 bits (134), Expect = 4e-06 Identities = 23/43 (53%), Positives = 31/43 (72%) Frame = -1 Query: 430 GAFKFQEAGWNPKEQIFEGYSNGYRSLLATVHAIDIDWDQRKE 302 GAF Q AGW+PKE+ +GYS Y+ + +VH DI+WDQ+KE Sbjct: 682 GAFNCQGAGWDPKERRIKGYSECYKLMSGSVHVTDIEWDQKKE 724 >XP_002320969.2 stachyose synthase family protein [Populus trichocarpa] EEE99284.2 stachyose synthase family protein [Populus trichocarpa] Length = 867 Score = 56.2 bits (134), Expect = 4e-06 Identities = 23/43 (53%), Positives = 31/43 (72%) Frame = -1 Query: 430 GAFKFQEAGWNPKEQIFEGYSNGYRSLLATVHAIDIDWDQRKE 302 GAF Q AGW+PKE+ +GYS Y+ + +VH DI+WDQ+KE Sbjct: 682 GAFNCQGAGWDPKERRIKGYSECYKLMSGSVHVTDIEWDQKKE 724 >AAR31209.1 stachyose synthase, partial [Medicago sativa] Length = 263 Score = 55.5 bits (132), Expect = 4e-06 Identities = 21/43 (48%), Positives = 30/43 (69%) Frame = -1 Query: 430 GAFKFQEAGWNPKEQIFEGYSNGYRSLLATVHAIDIDWDQRKE 302 GAF Q AGW+PKE F G+ Y+ ++ TVH +++WDQ+KE Sbjct: 118 GAFNCQGAGWDPKEHKFRGFPECYKPIVGTVHVTEVEWDQKKE 160 >CAC86963.1 stachyose synthase [Stachys affinis] Length = 863 Score = 55.8 bits (133), Expect = 5e-06 Identities = 24/43 (55%), Positives = 30/43 (69%) Frame = -1 Query: 430 GAFKFQEAGWNPKEQIFEGYSNGYRSLLATVHAIDIDWDQRKE 302 GAF Q AGW+PKEQ +GYS Y+ L +VH DI+WDQ+ E Sbjct: 682 GAFNCQGAGWDPKEQRIKGYSECYKPLSGSVHVSDIEWDQKVE 724 >XP_006287033.1 hypothetical protein CARUB_v10000180mg, partial [Capsella rubella] EOA19931.1 hypothetical protein CARUB_v10000180mg, partial [Capsella rubella] Length = 893 Score = 55.8 bits (133), Expect = 5e-06 Identities = 23/43 (53%), Positives = 29/43 (67%) Frame = -1 Query: 430 GAFKFQEAGWNPKEQIFEGYSNGYRSLLATVHAIDIDWDQRKE 302 GAF Q AGW+PKE +F+GY Y ++ TVH DI+WDQ E Sbjct: 706 GAFNCQGAGWSPKENMFKGYKECYTTVSGTVHVSDIEWDQNPE 748 >KFK35650.1 hypothetical protein AALP_AA4G018400 [Arabis alpina] Length = 762 Score = 55.5 bits (132), Expect = 7e-06 Identities = 23/59 (38%), Positives = 35/59 (59%) Frame = -1 Query: 430 GAFKFQEAGWNPKEQIFEGYSNGYRSLLATVHAIDIDWDQRKETILCIGATRGEETMFK 254 GAF Q AGW+PK+ F+GY Y+++ TVH D++WDQ E + G+ ++K Sbjct: 575 GAFNCQGAGWSPKKHRFKGYKECYKTISGTVHLSDVEWDQNPEAASSQASYAGDYLVYK 633