BLASTX nr result
ID: Panax24_contig00040680
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00040680 (462 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CAB61886.1 ribosomal protein L17, partial [Solanum lycopersicum] 63 2e-10 CDY71613.1 BnaAnng38170D [Brassica napus] 63 3e-10 CDX89821.1 BnaA10g02610D [Brassica napus] 63 3e-10 XP_013589007.1 PREDICTED: 60S ribosomal protein L23-like [Brassi... 63 3e-10 AEC11015.1 ribosomal protein L23, partial [Camellia sinensis] 63 4e-10 EEC74483.1 hypothetical protein OsI_09941 [Oryza sativa Indica G... 62 5e-10 XP_006378593.1 60S ribosomal protein L23 [Populus trichocarpa] E... 62 6e-10 XP_016460232.1 PREDICTED: 60S ribosomal protein L23-like isoform... 63 6e-10 XP_009614474.1 PREDICTED: 60S ribosomal protein L23-like isoform... 63 6e-10 AGU71397.1 60S ribosomal protein l23, partial [Lumnitzera racemosa] 62 6e-10 XP_017219612.1 PREDICTED: 60S ribosomal protein L23-like [Daucus... 63 7e-10 OAE23642.1 hypothetical protein AXG93_4720s1070 [Marchantia poly... 63 8e-10 KGN46379.1 hypothetical protein Csa_6G088070 [Cucumis sativus] 63 8e-10 XP_009773907.1 PREDICTED: 60S ribosomal protein L23-like isoform... 63 8e-10 XP_009614475.1 PREDICTED: 60S ribosomal protein L23-like isoform... 63 8e-10 EYU32582.1 hypothetical protein MIMGU_mgv1a015942mg [Erythranthe... 63 8e-10 XP_006857497.1 PREDICTED: 60S ribosomal protein L23 [Amborella t... 63 8e-10 XP_015078273.1 PREDICTED: 60S ribosomal protein L23 [Solanum pen... 63 8e-10 XP_003625360.1 60S ribosomal L23-like protein [Medicago truncatu... 63 8e-10 NP_001189805.1 Ribosomal protein L14p/L23e family protein [Arabi... 63 8e-10 >CAB61886.1 ribosomal protein L17, partial [Solanum lycopersicum] Length = 60 Score = 62.8 bits (151), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +2 Query: 2 KPWRRKDGVFMYFEDNAGVIVNPKGEM 82 KPWRRKDGVFMYFEDNAGVIVNPKGEM Sbjct: 6 KPWRRKDGVFMYFEDNAGVIVNPKGEM 32 >CDY71613.1 BnaAnng38170D [Brassica napus] Length = 79 Score = 62.8 bits (151), Expect = 3e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +2 Query: 2 KPWRRKDGVFMYFEDNAGVIVNPKGEM 82 KPWRRKDGVFMYFEDNAGVIVNPKGEM Sbjct: 46 KPWRRKDGVFMYFEDNAGVIVNPKGEM 72 >CDX89821.1 BnaA10g02610D [Brassica napus] Length = 81 Score = 62.8 bits (151), Expect = 3e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +2 Query: 2 KPWRRKDGVFMYFEDNAGVIVNPKGEM 82 KPWRRKDGVFMYFEDNAGVIVNPKGEM Sbjct: 27 KPWRRKDGVFMYFEDNAGVIVNPKGEM 53 >XP_013589007.1 PREDICTED: 60S ribosomal protein L23-like [Brassica oleracea var. oleracea] CDY49340.1 BnaA05g33020D [Brassica napus] CDY21127.1 BnaA01g33580D [Brassica napus] CDX86631.1 BnaC08g00720D [Brassica napus] Length = 81 Score = 62.8 bits (151), Expect = 3e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +2 Query: 2 KPWRRKDGVFMYFEDNAGVIVNPKGEM 82 KPWRRKDGVFMYFEDNAGVIVNPKGEM Sbjct: 27 KPWRRKDGVFMYFEDNAGVIVNPKGEM 53 >AEC11015.1 ribosomal protein L23, partial [Camellia sinensis] Length = 93 Score = 62.8 bits (151), Expect = 4e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +2 Query: 2 KPWRRKDGVFMYFEDNAGVIVNPKGEM 82 KPWRRKDGVFMYFEDNAGVIVNPKGEM Sbjct: 39 KPWRRKDGVFMYFEDNAGVIVNPKGEM 65 >EEC74483.1 hypothetical protein OsI_09941 [Oryza sativa Indica Group] Length = 64 Score = 61.6 bits (148), Expect = 5e-10 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = +2 Query: 2 KPWRRKDGVFMYFEDNAGVIVNPKGEM 82 KPWRRKDGV+MYFEDNAGVIVNPKGEM Sbjct: 10 KPWRRKDGVYMYFEDNAGVIVNPKGEM 36 >XP_006378593.1 60S ribosomal protein L23 [Populus trichocarpa] ERP56390.1 60S ribosomal protein L23 [Populus trichocarpa] Length = 95 Score = 62.4 bits (150), Expect = 6e-10 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = +2 Query: 2 KPWRRKDGVFMYFEDNAGVIVNPKGEM 82 KPWRRKDG+FMYFEDNAGVIVNPKGEM Sbjct: 27 KPWRRKDGIFMYFEDNAGVIVNPKGEM 53 >XP_016460232.1 PREDICTED: 60S ribosomal protein L23-like isoform X1 [Nicotiana tabacum] Length = 126 Score = 63.2 bits (152), Expect = 6e-10 Identities = 28/30 (93%), Positives = 28/30 (93%) Frame = +2 Query: 2 KPWRRKDGVFMYFEDNAGVIVNPKGEMT*F 91 KPWRRKDGVFMYFEDNAGVIVNPKGEM F Sbjct: 86 KPWRRKDGVFMYFEDNAGVIVNPKGEMKRF 115 >XP_009614474.1 PREDICTED: 60S ribosomal protein L23-like isoform X2 [Nicotiana tomentosiformis] Length = 126 Score = 63.2 bits (152), Expect = 6e-10 Identities = 28/30 (93%), Positives = 28/30 (93%) Frame = +2 Query: 2 KPWRRKDGVFMYFEDNAGVIVNPKGEMT*F 91 KPWRRKDGVFMYFEDNAGVIVNPKGEM F Sbjct: 86 KPWRRKDGVFMYFEDNAGVIVNPKGEMKRF 115 >AGU71397.1 60S ribosomal protein l23, partial [Lumnitzera racemosa] Length = 71 Score = 61.6 bits (148), Expect = 6e-10 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = +2 Query: 2 KPWRRKDGVFMYFEDNAGVIVNPKGEM 82 KPWRRKDGV+MYFEDNAGVIVNPKGEM Sbjct: 44 KPWRRKDGVYMYFEDNAGVIVNPKGEM 70 >XP_017219612.1 PREDICTED: 60S ribosomal protein L23-like [Daucus carota subsp. sativus] Length = 116 Score = 62.8 bits (151), Expect = 7e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +2 Query: 2 KPWRRKDGVFMYFEDNAGVIVNPKGEM 82 KPWRRKDGVFMYFEDNAGVIVNPKGEM Sbjct: 86 KPWRRKDGVFMYFEDNAGVIVNPKGEM 112 >OAE23642.1 hypothetical protein AXG93_4720s1070 [Marchantia polymorpha subsp. polymorpha] Length = 125 Score = 62.8 bits (151), Expect = 8e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +2 Query: 2 KPWRRKDGVFMYFEDNAGVIVNPKGEM 82 KPWRRKDGVFMYFEDNAGVIVNPKGEM Sbjct: 71 KPWRRKDGVFMYFEDNAGVIVNPKGEM 97 >KGN46379.1 hypothetical protein Csa_6G088070 [Cucumis sativus] Length = 125 Score = 62.8 bits (151), Expect = 8e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +2 Query: 2 KPWRRKDGVFMYFEDNAGVIVNPKGEM 82 KPWRRKDGVFMYFEDNAGVIVNPKGEM Sbjct: 71 KPWRRKDGVFMYFEDNAGVIVNPKGEM 97 >XP_009773907.1 PREDICTED: 60S ribosomal protein L23-like isoform X3 [Nicotiana sylvestris] XP_016499310.1 PREDICTED: 60S ribosomal protein L23-like isoform X1 [Nicotiana tabacum] Length = 125 Score = 62.8 bits (151), Expect = 8e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +2 Query: 2 KPWRRKDGVFMYFEDNAGVIVNPKGEM 82 KPWRRKDGVFMYFEDNAGVIVNPKGEM Sbjct: 71 KPWRRKDGVFMYFEDNAGVIVNPKGEM 97 >XP_009614475.1 PREDICTED: 60S ribosomal protein L23-like isoform X3 [Nicotiana tomentosiformis] XP_018630074.1 PREDICTED: 60S ribosomal protein L23-like isoform X3 [Nicotiana tomentosiformis] Length = 125 Score = 62.8 bits (151), Expect = 8e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +2 Query: 2 KPWRRKDGVFMYFEDNAGVIVNPKGEM 82 KPWRRKDGVFMYFEDNAGVIVNPKGEM Sbjct: 71 KPWRRKDGVFMYFEDNAGVIVNPKGEM 97 >EYU32582.1 hypothetical protein MIMGU_mgv1a015942mg [Erythranthe guttata] Length = 125 Score = 62.8 bits (151), Expect = 8e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +2 Query: 2 KPWRRKDGVFMYFEDNAGVIVNPKGEM 82 KPWRRKDGVFMYFEDNAGVIVNPKGEM Sbjct: 71 KPWRRKDGVFMYFEDNAGVIVNPKGEM 97 >XP_006857497.1 PREDICTED: 60S ribosomal protein L23 [Amborella trichopoda] ERN18964.1 hypothetical protein AMTR_s00067p00206470 [Amborella trichopoda] Length = 125 Score = 62.8 bits (151), Expect = 8e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +2 Query: 2 KPWRRKDGVFMYFEDNAGVIVNPKGEM 82 KPWRRKDGVFMYFEDNAGVIVNPKGEM Sbjct: 71 KPWRRKDGVFMYFEDNAGVIVNPKGEM 97 >XP_015078273.1 PREDICTED: 60S ribosomal protein L23 [Solanum pennellii] EMT07675.1 60S ribosomal protein L23 [Aegilops tauschii] KVH91014.1 Ribosomal protein L14b/L23e [Cynara cardunculus var. scolymus] KZV46744.1 hypothetical protein F511_35728 [Dorcoceras hygrometricum] Length = 125 Score = 62.8 bits (151), Expect = 8e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +2 Query: 2 KPWRRKDGVFMYFEDNAGVIVNPKGEM 82 KPWRRKDGVFMYFEDNAGVIVNPKGEM Sbjct: 71 KPWRRKDGVFMYFEDNAGVIVNPKGEM 97 >XP_003625360.1 60S ribosomal L23-like protein [Medicago truncatula] AES81578.1 60S ribosomal L23-like protein [Medicago truncatula] Length = 125 Score = 62.8 bits (151), Expect = 8e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +2 Query: 2 KPWRRKDGVFMYFEDNAGVIVNPKGEM 82 KPWRRKDGVFMYFEDNAGVIVNPKGEM Sbjct: 71 KPWRRKDGVFMYFEDNAGVIVNPKGEM 97 >NP_001189805.1 Ribosomal protein L14p/L23e family protein [Arabidopsis thaliana] NP_001324123.1 Ribosomal protein L14p/L23e family protein [Arabidopsis thaliana] AEE74077.1 Ribosomal protein L14p/L23e family protein [Arabidopsis thaliana] ANM61934.1 Ribosomal protein L14p/L23e family protein [Arabidopsis thaliana] Length = 125 Score = 62.8 bits (151), Expect = 8e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +2 Query: 2 KPWRRKDGVFMYFEDNAGVIVNPKGEM 82 KPWRRKDGVFMYFEDNAGVIVNPKGEM Sbjct: 71 KPWRRKDGVFMYFEDNAGVIVNPKGEM 97