BLASTX nr result
ID: Panax24_contig00040652
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00040652 (498 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value OAL02573.1 hypothetical protein IQ06DRAFT_334208 [Stagonospora s... 51 7e-06 >OAL02573.1 hypothetical protein IQ06DRAFT_334208 [Stagonospora sp. SRC1lsM3a] Length = 64 Score = 51.2 bits (121), Expect = 7e-06 Identities = 30/62 (48%), Positives = 37/62 (59%), Gaps = 4/62 (6%) Frame = -1 Query: 330 DTFSTHDLPTSSQLI*LHCAIQP---SGYVIRRIA-ARELSTTTSEGDDCAGLGNVMGCW 163 D FSTH+LP SQL L A++ GYVI R TT++G +CAGLG +GCW Sbjct: 3 DMFSTHNLPARSQL--LSAALRSFGLPGYVIWRTRDTASFKITTTDGHECAGLGITIGCW 60 Query: 162 SI 157 SI Sbjct: 61 SI 62