BLASTX nr result
ID: Panax24_contig00040515
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00040515 (560 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_019707309.1 PREDICTED: CBL-interacting protein kinase 8-like ... 56 5e-07 XP_014509554.1 PREDICTED: CBL-interacting serine/threonine-prote... 59 5e-07 XP_013458092.1 CBL-interacting kinase [Medicago truncatula] KEH3... 59 5e-07 KYP55704.1 CBL-interacting serine/threonine-protein kinase 24 [C... 59 6e-07 XP_003609347.2 CBL-interacting kinase [Medicago truncatula] AES9... 59 6e-07 KRH03686.1 hypothetical protein GLYMA_17G113700 [Glycine max] 59 6e-07 KOM33026.1 hypothetical protein LR48_Vigan01g258200 [Vigna angul... 59 6e-07 XP_003609346.2 CBL-interacting kinase [Medicago truncatula] AES9... 59 6e-07 XP_003549757.1 PREDICTED: CBL-interacting serine/threonine-prote... 59 6e-07 XP_014509552.1 PREDICTED: CBL-interacting serine/threonine-prote... 59 6e-07 XP_007155013.1 hypothetical protein PHAVU_003G165700g [Phaseolus... 59 6e-07 XP_017405819.1 PREDICTED: CBL-interacting serine/threonine-prote... 59 6e-07 XP_017252456.1 PREDICTED: CBL-interacting protein kinase 24 isof... 59 7e-07 BAD95977.1 Ser/Thr protein kinase [Lotus japonicus] 58 1e-06 KVI11664.1 NAF domain-containing protein [Cynara cardunculus var... 58 1e-06 BAD95978.1 Ser/Thr protein kinase [Lotus japonicus] 58 1e-06 KJB64753.1 hypothetical protein B456_010G063300 [Gossypium raimo... 57 2e-06 KJB64754.1 hypothetical protein B456_010G063300 [Gossypium raimo... 57 2e-06 KDO80232.1 hypothetical protein CISIN_1g013421mg [Citrus sinensis] 57 2e-06 KJB64759.1 hypothetical protein B456_010G063300 [Gossypium raimo... 57 2e-06 >XP_019707309.1 PREDICTED: CBL-interacting protein kinase 8-like isoform X1 [Elaeis guineensis] Length = 106 Score = 55.8 bits (133), Expect = 5e-07 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = -3 Query: 87 QIKREISIMKIVRHPNIVRLHEVLASQTK 1 QIKREISIMKIVRHPNIVRLHEVL S+TK Sbjct: 53 QIKREISIMKIVRHPNIVRLHEVLVSRTK 81 >XP_014509554.1 PREDICTED: CBL-interacting serine/threonine-protein kinase 24 isoform X3 [Vigna radiata var. radiata] Length = 358 Score = 58.9 bits (141), Expect = 5e-07 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = -3 Query: 87 QIKREISIMKIVRHPNIVRLHEVLASQTK 1 QIKREISIMKIVRHPNIVRLHEVLASQTK Sbjct: 61 QIKREISIMKIVRHPNIVRLHEVLASQTK 89 >XP_013458092.1 CBL-interacting kinase [Medicago truncatula] KEH32123.1 CBL-interacting kinase [Medicago truncatula] Length = 381 Score = 58.9 bits (141), Expect = 5e-07 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = -3 Query: 87 QIKREISIMKIVRHPNIVRLHEVLASQTK 1 QIKREISIMKIVRHPNIVRLHEVLASQTK Sbjct: 55 QIKREISIMKIVRHPNIVRLHEVLASQTK 83 >KYP55704.1 CBL-interacting serine/threonine-protein kinase 24 [Cajanus cajan] Length = 420 Score = 58.9 bits (141), Expect = 6e-07 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = -3 Query: 87 QIKREISIMKIVRHPNIVRLHEVLASQTK 1 QIKREISIMKIVRHPNIVRLHEVLASQTK Sbjct: 55 QIKREISIMKIVRHPNIVRLHEVLASQTK 83 >XP_003609347.2 CBL-interacting kinase [Medicago truncatula] AES91544.2 CBL-interacting kinase [Medicago truncatula] Length = 433 Score = 58.9 bits (141), Expect = 6e-07 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = -3 Query: 87 QIKREISIMKIVRHPNIVRLHEVLASQTK 1 QIKREISIMKIVRHPNIVRLHEVLASQTK Sbjct: 55 QIKREISIMKIVRHPNIVRLHEVLASQTK 83 >KRH03686.1 hypothetical protein GLYMA_17G113700 [Glycine max] Length = 444 Score = 58.9 bits (141), Expect = 6e-07 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = -3 Query: 87 QIKREISIMKIVRHPNIVRLHEVLASQTK 1 QIKREISIMKIVRHPNIVRLHEVLASQTK Sbjct: 55 QIKREISIMKIVRHPNIVRLHEVLASQTK 83 >KOM33026.1 hypothetical protein LR48_Vigan01g258200 [Vigna angularis] Length = 444 Score = 58.9 bits (141), Expect = 6e-07 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = -3 Query: 87 QIKREISIMKIVRHPNIVRLHEVLASQTK 1 QIKREISIMKIVRHPNIVRLHEVLASQTK Sbjct: 54 QIKREISIMKIVRHPNIVRLHEVLASQTK 82 >XP_003609346.2 CBL-interacting kinase [Medicago truncatula] AES91543.2 CBL-interacting kinase [Medicago truncatula] Length = 446 Score = 58.9 bits (141), Expect = 6e-07 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = -3 Query: 87 QIKREISIMKIVRHPNIVRLHEVLASQTK 1 QIKREISIMKIVRHPNIVRLHEVLASQTK Sbjct: 55 QIKREISIMKIVRHPNIVRLHEVLASQTK 83 >XP_003549757.1 PREDICTED: CBL-interacting serine/threonine-protein kinase 24 [Glycine max] KHN15082.1 CBL-interacting protein kinase 24 [Glycine soja] KRH03685.1 hypothetical protein GLYMA_17G113700 [Glycine max] Length = 446 Score = 58.9 bits (141), Expect = 6e-07 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = -3 Query: 87 QIKREISIMKIVRHPNIVRLHEVLASQTK 1 QIKREISIMKIVRHPNIVRLHEVLASQTK Sbjct: 55 QIKREISIMKIVRHPNIVRLHEVLASQTK 83 >XP_014509552.1 PREDICTED: CBL-interacting serine/threonine-protein kinase 24 isoform X1 [Vigna radiata var. radiata] Length = 452 Score = 58.9 bits (141), Expect = 6e-07 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = -3 Query: 87 QIKREISIMKIVRHPNIVRLHEVLASQTK 1 QIKREISIMKIVRHPNIVRLHEVLASQTK Sbjct: 61 QIKREISIMKIVRHPNIVRLHEVLASQTK 89 >XP_007155013.1 hypothetical protein PHAVU_003G165700g [Phaseolus vulgaris] ESW27007.1 hypothetical protein PHAVU_003G165700g [Phaseolus vulgaris] Length = 452 Score = 58.9 bits (141), Expect = 6e-07 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = -3 Query: 87 QIKREISIMKIVRHPNIVRLHEVLASQTK 1 QIKREISIMKIVRHPNIVRLHEVLASQTK Sbjct: 61 QIKREISIMKIVRHPNIVRLHEVLASQTK 89 >XP_017405819.1 PREDICTED: CBL-interacting serine/threonine-protein kinase 24 [Vigna angularis] BAT76346.1 hypothetical protein VIGAN_01433000 [Vigna angularis var. angularis] Length = 453 Score = 58.9 bits (141), Expect = 6e-07 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = -3 Query: 87 QIKREISIMKIVRHPNIVRLHEVLASQTK 1 QIKREISIMKIVRHPNIVRLHEVLASQTK Sbjct: 61 QIKREISIMKIVRHPNIVRLHEVLASQTK 89 >XP_017252456.1 PREDICTED: CBL-interacting protein kinase 24 isoform X2 [Daucus carota subsp. sativus] Length = 399 Score = 58.5 bits (140), Expect = 7e-07 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -3 Query: 90 FQIKREISIMKIVRHPNIVRLHEVLASQTK 1 FQIKREISIMKIVRHPNIVRL+EVLASQTK Sbjct: 21 FQIKREISIMKIVRHPNIVRLNEVLASQTK 50 >BAD95977.1 Ser/Thr protein kinase [Lotus japonicus] Length = 365 Score = 57.8 bits (138), Expect = 1e-06 Identities = 28/29 (96%), Positives = 29/29 (100%) Frame = -3 Query: 87 QIKREISIMKIVRHPNIVRLHEVLASQTK 1 QIKREISIMKIVRHPNIVRLHEVL+SQTK Sbjct: 4 QIKREISIMKIVRHPNIVRLHEVLSSQTK 32 >KVI11664.1 NAF domain-containing protein [Cynara cardunculus var. scolymus] Length = 394 Score = 57.8 bits (138), Expect = 1e-06 Identities = 28/29 (96%), Positives = 29/29 (100%) Frame = -3 Query: 87 QIKREISIMKIVRHPNIVRLHEVLASQTK 1 QIKREISIMKIVRHPNIVRLHEVL+SQTK Sbjct: 56 QIKREISIMKIVRHPNIVRLHEVLSSQTK 84 >BAD95978.1 Ser/Thr protein kinase [Lotus japonicus] Length = 446 Score = 57.8 bits (138), Expect = 1e-06 Identities = 28/29 (96%), Positives = 29/29 (100%) Frame = -3 Query: 87 QIKREISIMKIVRHPNIVRLHEVLASQTK 1 QIKREISIMKIVRHPNIVRLHEVL+SQTK Sbjct: 55 QIKREISIMKIVRHPNIVRLHEVLSSQTK 83 >KJB64753.1 hypothetical protein B456_010G063300 [Gossypium raimondii] Length = 343 Score = 57.4 bits (137), Expect = 2e-06 Identities = 28/29 (96%), Positives = 29/29 (100%) Frame = -3 Query: 87 QIKREISIMKIVRHPNIVRLHEVLASQTK 1 QIKREISIMKIVRHPNIVRLHEVLAS+TK Sbjct: 55 QIKREISIMKIVRHPNIVRLHEVLASRTK 83 >KJB64754.1 hypothetical protein B456_010G063300 [Gossypium raimondii] Length = 371 Score = 57.4 bits (137), Expect = 2e-06 Identities = 28/29 (96%), Positives = 29/29 (100%) Frame = -3 Query: 87 QIKREISIMKIVRHPNIVRLHEVLASQTK 1 QIKREISIMKIVRHPNIVRLHEVLAS+TK Sbjct: 55 QIKREISIMKIVRHPNIVRLHEVLASRTK 83 >KDO80232.1 hypothetical protein CISIN_1g013421mg [Citrus sinensis] Length = 379 Score = 57.4 bits (137), Expect = 2e-06 Identities = 28/29 (96%), Positives = 29/29 (100%) Frame = -3 Query: 87 QIKREISIMKIVRHPNIVRLHEVLASQTK 1 QIKREISIMKIVRHPNIVRLHEVLAS+TK Sbjct: 55 QIKREISIMKIVRHPNIVRLHEVLASRTK 83 >KJB64759.1 hypothetical protein B456_010G063300 [Gossypium raimondii] Length = 381 Score = 57.4 bits (137), Expect = 2e-06 Identities = 28/29 (96%), Positives = 29/29 (100%) Frame = -3 Query: 87 QIKREISIMKIVRHPNIVRLHEVLASQTK 1 QIKREISIMKIVRHPNIVRLHEVLAS+TK Sbjct: 55 QIKREISIMKIVRHPNIVRLHEVLASRTK 83