BLASTX nr result
ID: Panax24_contig00040368
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00040368 (495 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_004138516.1 PREDICTED: 5'-nucleotidase domain-containing prot... 78 1e-13 ONM00169.1 65-kDa microtubule-associated protein 3 [Zea mays] AQ... 74 1e-13 XP_019075749.1 PREDICTED: cytosolic purine 5'-nucleotidase isofo... 77 1e-13 XP_018809453.1 PREDICTED: 5'-nucleotidase domain-containing prot... 77 1e-13 XP_003631966.1 PREDICTED: 5'-nucleotidase domain-containing prot... 77 1e-13 ONL99963.1 65-kDa microtubule-associated protein 3 [Zea mays] ON... 73 2e-13 XP_012482301.1 PREDICTED: 5'-nucleotidase domain-containing prot... 77 2e-13 KJB28866.1 hypothetical protein B456_005G073300 [Gossypium raimo... 77 2e-13 XP_017631837.1 PREDICTED: 5'-nucleotidase domain-containing prot... 77 2e-13 XP_016742124.1 PREDICTED: 5'-nucleotidase domain-containing prot... 77 2e-13 XP_012482299.1 PREDICTED: 5'-nucleotidase domain-containing prot... 77 2e-13 GAV85337.1 5_nucleotid domain-containing protein [Cephalotus fol... 77 2e-13 XP_016742123.1 PREDICTED: 5'-nucleotidase domain-containing prot... 77 2e-13 XP_017631836.1 PREDICTED: 5'-nucleotidase domain-containing prot... 77 2e-13 JAT52346.1 Cytosolic purine 5'-nucleotidase [Anthurium amnicola]... 77 3e-13 XP_009414923.1 PREDICTED: cytosolic purine 5'-nucleotidase isofo... 76 3e-13 XP_009414922.1 PREDICTED: 5'-nucleotidase domain-containing prot... 76 4e-13 XP_009359802.1 PREDICTED: 5'-nucleotidase domain-containing prot... 76 5e-13 XP_008360216.1 PREDICTED: 5'-nucleotidase domain-containing prot... 76 5e-13 XP_009353424.1 PREDICTED: 5'-nucleotidase domain-containing prot... 76 5e-13 >XP_004138516.1 PREDICTED: 5'-nucleotidase domain-containing protein 4 [Cucumis sativus] KGN45629.1 hypothetical protein Csa_6G001750 [Cucumis sativus] Length = 610 Score = 77.8 bits (190), Expect = 1e-13 Identities = 35/40 (87%), Positives = 38/40 (95%) Frame = +2 Query: 23 AGKKLLLITNSDYHYTNKMMQHSFDSFLPNDIGRRDLFDM 142 AGKKLLLITNSDYHYTNKMMQHSF+ FLPND+G RDLFD+ Sbjct: 325 AGKKLLLITNSDYHYTNKMMQHSFNKFLPNDMGWRDLFDI 364 >ONM00169.1 65-kDa microtubule-associated protein 3 [Zea mays] AQL06190.1 65-kDa microtubule-associated protein 3 [Zea mays] Length = 143 Score = 73.6 bits (179), Expect = 1e-13 Identities = 32/40 (80%), Positives = 37/40 (92%) Frame = +2 Query: 23 AGKKLLLITNSDYHYTNKMMQHSFDSFLPNDIGRRDLFDM 142 AGKKLLLITNSD+HYTNKMM H+F+ FLPND+G RDLF+M Sbjct: 11 AGKKLLLITNSDFHYTNKMMNHAFNRFLPNDVGWRDLFEM 50 >XP_019075749.1 PREDICTED: cytosolic purine 5'-nucleotidase isoform X2 [Vitis vinifera] Length = 601 Score = 77.4 bits (189), Expect = 1e-13 Identities = 35/40 (87%), Positives = 38/40 (95%) Frame = +2 Query: 23 AGKKLLLITNSDYHYTNKMMQHSFDSFLPNDIGRRDLFDM 142 AGKKLLLITNSDYHYT+KMMQHSF+ FLPND+G RDLFDM Sbjct: 297 AGKKLLLITNSDYHYTDKMMQHSFNKFLPNDMGWRDLFDM 336 >XP_018809453.1 PREDICTED: 5'-nucleotidase domain-containing protein 4-like [Juglans regia] Length = 629 Score = 77.4 bits (189), Expect = 1e-13 Identities = 35/40 (87%), Positives = 38/40 (95%) Frame = +2 Query: 23 AGKKLLLITNSDYHYTNKMMQHSFDSFLPNDIGRRDLFDM 142 AGKKLLLITNSDYHYTNKMMQHSF+ FLPND+G RDLFD+ Sbjct: 343 AGKKLLLITNSDYHYTNKMMQHSFNRFLPNDMGWRDLFDI 382 >XP_003631966.1 PREDICTED: 5'-nucleotidase domain-containing protein 4 isoform X1 [Vitis vinifera] CBI26019.3 unnamed protein product, partial [Vitis vinifera] Length = 641 Score = 77.4 bits (189), Expect = 1e-13 Identities = 35/40 (87%), Positives = 38/40 (95%) Frame = +2 Query: 23 AGKKLLLITNSDYHYTNKMMQHSFDSFLPNDIGRRDLFDM 142 AGKKLLLITNSDYHYT+KMMQHSF+ FLPND+G RDLFDM Sbjct: 337 AGKKLLLITNSDYHYTDKMMQHSFNKFLPNDMGWRDLFDM 376 >ONL99963.1 65-kDa microtubule-associated protein 3 [Zea mays] ONL99966.1 65-kDa microtubule-associated protein 3 [Zea mays] Length = 143 Score = 73.2 bits (178), Expect = 2e-13 Identities = 32/40 (80%), Positives = 36/40 (90%) Frame = +2 Query: 23 AGKKLLLITNSDYHYTNKMMQHSFDSFLPNDIGRRDLFDM 142 AGKKLLLITNSD+HYTNKMM H+F FLPND+G RDLF+M Sbjct: 11 AGKKLLLITNSDFHYTNKMMNHAFSRFLPNDVGWRDLFEM 50 >XP_012482301.1 PREDICTED: 5'-nucleotidase domain-containing protein 4 isoform X2 [Gossypium raimondii] Length = 542 Score = 77.0 bits (188), Expect = 2e-13 Identities = 35/40 (87%), Positives = 38/40 (95%) Frame = +2 Query: 23 AGKKLLLITNSDYHYTNKMMQHSFDSFLPNDIGRRDLFDM 142 AGKKLLLITNSDYHYT+KMMQHSF+ FLPND+G RDLFDM Sbjct: 320 AGKKLLLITNSDYHYTDKMMQHSFNRFLPNDMGWRDLFDM 359 >KJB28866.1 hypothetical protein B456_005G073300 [Gossypium raimondii] KJB28867.1 hypothetical protein B456_005G073300 [Gossypium raimondii] Length = 560 Score = 77.0 bits (188), Expect = 2e-13 Identities = 35/40 (87%), Positives = 38/40 (95%) Frame = +2 Query: 23 AGKKLLLITNSDYHYTNKMMQHSFDSFLPNDIGRRDLFDM 142 AGKKLLLITNSDYHYT+KMMQHSF+ FLPND+G RDLFDM Sbjct: 320 AGKKLLLITNSDYHYTDKMMQHSFNRFLPNDMGWRDLFDM 359 >XP_017631837.1 PREDICTED: 5'-nucleotidase domain-containing protein 4 isoform X2 [Gossypium arboreum] Length = 605 Score = 77.0 bits (188), Expect = 2e-13 Identities = 35/40 (87%), Positives = 38/40 (95%) Frame = +2 Query: 23 AGKKLLLITNSDYHYTNKMMQHSFDSFLPNDIGRRDLFDM 142 AGKKLLLITNSDYHYT+KMMQHSF+ FLPND+G RDLFDM Sbjct: 320 AGKKLLLITNSDYHYTDKMMQHSFNRFLPNDMGWRDLFDM 359 >XP_016742124.1 PREDICTED: 5'-nucleotidase domain-containing protein 4-like isoform X2 [Gossypium hirsutum] Length = 605 Score = 77.0 bits (188), Expect = 2e-13 Identities = 35/40 (87%), Positives = 38/40 (95%) Frame = +2 Query: 23 AGKKLLLITNSDYHYTNKMMQHSFDSFLPNDIGRRDLFDM 142 AGKKLLLITNSDYHYT+KMMQHSF+ FLPND+G RDLFDM Sbjct: 320 AGKKLLLITNSDYHYTDKMMQHSFNRFLPNDMGWRDLFDM 359 >XP_012482299.1 PREDICTED: 5'-nucleotidase domain-containing protein 4 isoform X1 [Gossypium raimondii] XP_012482300.1 PREDICTED: 5'-nucleotidase domain-containing protein 4 isoform X1 [Gossypium raimondii] KJB28865.1 hypothetical protein B456_005G073300 [Gossypium raimondii] KJB28868.1 hypothetical protein B456_005G073300 [Gossypium raimondii] Length = 605 Score = 77.0 bits (188), Expect = 2e-13 Identities = 35/40 (87%), Positives = 38/40 (95%) Frame = +2 Query: 23 AGKKLLLITNSDYHYTNKMMQHSFDSFLPNDIGRRDLFDM 142 AGKKLLLITNSDYHYT+KMMQHSF+ FLPND+G RDLFDM Sbjct: 320 AGKKLLLITNSDYHYTDKMMQHSFNRFLPNDMGWRDLFDM 359 >GAV85337.1 5_nucleotid domain-containing protein [Cephalotus follicularis] Length = 618 Score = 77.0 bits (188), Expect = 2e-13 Identities = 35/40 (87%), Positives = 38/40 (95%) Frame = +2 Query: 23 AGKKLLLITNSDYHYTNKMMQHSFDSFLPNDIGRRDLFDM 142 AGKKLLLITNSDYHYT+KMMQHSF+ FLPND+G RDLFDM Sbjct: 326 AGKKLLLITNSDYHYTDKMMQHSFNRFLPNDMGWRDLFDM 365 >XP_016742123.1 PREDICTED: 5'-nucleotidase domain-containing protein 4-like isoform X1 [Gossypium hirsutum] Length = 621 Score = 77.0 bits (188), Expect = 2e-13 Identities = 35/40 (87%), Positives = 38/40 (95%) Frame = +2 Query: 23 AGKKLLLITNSDYHYTNKMMQHSFDSFLPNDIGRRDLFDM 142 AGKKLLLITNSDYHYT+KMMQHSF+ FLPND+G RDLFDM Sbjct: 336 AGKKLLLITNSDYHYTDKMMQHSFNRFLPNDMGWRDLFDM 375 >XP_017631836.1 PREDICTED: 5'-nucleotidase domain-containing protein 4 isoform X1 [Gossypium arboreum] KHG03386.1 Cytosolic purine 5'-nucleotidase [Gossypium arboreum] Length = 621 Score = 77.0 bits (188), Expect = 2e-13 Identities = 35/40 (87%), Positives = 38/40 (95%) Frame = +2 Query: 23 AGKKLLLITNSDYHYTNKMMQHSFDSFLPNDIGRRDLFDM 142 AGKKLLLITNSDYHYT+KMMQHSF+ FLPND+G RDLFDM Sbjct: 336 AGKKLLLITNSDYHYTDKMMQHSFNRFLPNDMGWRDLFDM 375 >JAT52346.1 Cytosolic purine 5'-nucleotidase [Anthurium amnicola] JAT55850.1 Cytosolic purine 5'-nucleotidase [Anthurium amnicola] Length = 622 Score = 76.6 bits (187), Expect = 3e-13 Identities = 34/40 (85%), Positives = 38/40 (95%) Frame = +2 Query: 23 AGKKLLLITNSDYHYTNKMMQHSFDSFLPNDIGRRDLFDM 142 AGK+LLLITNSDYHYTNKMMQH+F+ FLPND+G RDLFDM Sbjct: 334 AGKRLLLITNSDYHYTNKMMQHAFNRFLPNDMGWRDLFDM 373 >XP_009414923.1 PREDICTED: cytosolic purine 5'-nucleotidase isoform X2 [Musa acuminata subsp. malaccensis] Length = 505 Score = 76.3 bits (186), Expect = 3e-13 Identities = 34/40 (85%), Positives = 38/40 (95%) Frame = +2 Query: 23 AGKKLLLITNSDYHYTNKMMQHSFDSFLPNDIGRRDLFDM 142 AGKKLLLITNSDYHYTNKMMQH+F+ FLPND+G RDLF+M Sbjct: 217 AGKKLLLITNSDYHYTNKMMQHAFNRFLPNDMGWRDLFEM 256 >XP_009414922.1 PREDICTED: 5'-nucleotidase domain-containing protein 4 isoform X1 [Musa acuminata subsp. malaccensis] Length = 626 Score = 76.3 bits (186), Expect = 4e-13 Identities = 34/40 (85%), Positives = 38/40 (95%) Frame = +2 Query: 23 AGKKLLLITNSDYHYTNKMMQHSFDSFLPNDIGRRDLFDM 142 AGKKLLLITNSDYHYTNKMMQH+F+ FLPND+G RDLF+M Sbjct: 338 AGKKLLLITNSDYHYTNKMMQHAFNRFLPNDMGWRDLFEM 377 >XP_009359802.1 PREDICTED: 5'-nucleotidase domain-containing protein 4-like [Pyrus x bretschneideri] Length = 633 Score = 75.9 bits (185), Expect = 5e-13 Identities = 34/40 (85%), Positives = 38/40 (95%) Frame = +2 Query: 23 AGKKLLLITNSDYHYTNKMMQHSFDSFLPNDIGRRDLFDM 142 AGKKLLLITNSDYHYTNKMMQHSF+ FLPN++G RDLFD+ Sbjct: 341 AGKKLLLITNSDYHYTNKMMQHSFNRFLPNEMGWRDLFDI 380 >XP_008360216.1 PREDICTED: 5'-nucleotidase domain-containing protein 4-like [Malus domestica] Length = 633 Score = 75.9 bits (185), Expect = 5e-13 Identities = 34/40 (85%), Positives = 38/40 (95%) Frame = +2 Query: 23 AGKKLLLITNSDYHYTNKMMQHSFDSFLPNDIGRRDLFDM 142 AGKKLLLITNSDYHYTNKMMQHSF+ FLPN++G RDLFD+ Sbjct: 341 AGKKLLLITNSDYHYTNKMMQHSFNRFLPNEMGWRDLFDI 380 >XP_009353424.1 PREDICTED: 5'-nucleotidase domain-containing protein 4-like [Pyrus x bretschneideri] Length = 641 Score = 75.9 bits (185), Expect = 5e-13 Identities = 34/40 (85%), Positives = 38/40 (95%) Frame = +2 Query: 23 AGKKLLLITNSDYHYTNKMMQHSFDSFLPNDIGRRDLFDM 142 AGKKLLLITNSDYHYTNKMMQHSF+ FLPN++G RDLFD+ Sbjct: 349 AGKKLLLITNSDYHYTNKMMQHSFNRFLPNEMGWRDLFDI 388