BLASTX nr result
ID: Panax24_contig00040225
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00040225 (468 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AKJ26303.1 chloroplast heterodimeric geranylgeranyl pyrophosphat... 60 8e-08 XP_015899572.1 PREDICTED: heterodimeric geranylgeranyl pyrophosp... 60 8e-08 XP_017249855.1 PREDICTED: heterodimeric geranylgeranyl pyrophosp... 59 2e-07 ALT07955.1 putative geranyl diphosphate synthase small subunit t... 58 5e-07 XP_002532570.1 PREDICTED: heterodimeric geranylgeranyl pyrophosp... 58 6e-07 XP_012070840.1 PREDICTED: heterodimeric geranylgeranyl pyrophosp... 58 6e-07 XP_019231006.1 PREDICTED: heterodimeric geranylgeranyl pyrophosp... 57 9e-07 OIT29044.1 heterodimeric geranylgeranyl pyrophosphate synthase s... 57 1e-06 XP_002322072.2 hypothetical protein POPTR_0015s04050g [Populus t... 57 1e-06 XP_011007747.1 PREDICTED: heterodimeric geranylgeranyl pyrophosp... 56 2e-06 AGH33891.1 geranyl diphsophate synthase small subunit [Lavandula... 56 3e-06 XP_018811644.1 PREDICTED: heterodimeric geranylgeranyl pyrophosp... 56 3e-06 XP_019196842.1 PREDICTED: heterodimeric geranylgeranyl pyrophosp... 55 5e-06 XP_012460748.1 PREDICTED: heterodimeric geranylgeranyl pyrophosp... 55 5e-06 GAV72912.1 polyprenyl_synt domain-containing protein [Cephalotus... 55 5e-06 XP_015081852.1 PREDICTED: heterodimeric geranylgeranyl pyrophosp... 55 5e-06 XP_010324311.1 PREDICTED: heterodimeric geranylgeranyl pyrophosp... 55 5e-06 XP_011095406.1 PREDICTED: heterodimeric geranylgeranyl pyrophosp... 55 6e-06 XP_007214528.1 hypothetical protein PRUPE_ppa015010mg [Prunus pe... 54 9e-06 >AKJ26303.1 chloroplast heterodimeric geranylgeranyl pyrophosphate synthase small subunit [Paeonia lactiflora] Length = 298 Score = 60.1 bits (144), Expect = 8e-08 Identities = 24/33 (72%), Positives = 30/33 (90%) Frame = +2 Query: 368 SYWDAIDANIEAHLKKSIPIRPPIQVFEPMHHL 466 SYW ID++IEAHLK++IP+RPP+ VFEPMHHL Sbjct: 42 SYWATIDSDIEAHLKQAIPVRPPLVVFEPMHHL 74 >XP_015899572.1 PREDICTED: heterodimeric geranylgeranyl pyrophosphate synthase small subunit, chloroplastic-like [Ziziphus jujuba] Length = 303 Score = 60.1 bits (144), Expect = 8e-08 Identities = 24/38 (63%), Positives = 33/38 (86%) Frame = +2 Query: 350 MHGQDLSYWDAIDANIEAHLKKSIPIRPPIQVFEPMHH 463 M QD S+W +I+A+IEAHLK++IP+RPP+ VFEP+HH Sbjct: 35 MSQQDQSHWSSINADIEAHLKQAIPLRPPLSVFEPVHH 72 >XP_017249855.1 PREDICTED: heterodimeric geranylgeranyl pyrophosphate synthase small subunit, chloroplastic-like [Daucus carota subsp. sativus] KZM93465.1 hypothetical protein DCAR_016710 [Daucus carota subsp. sativus] Length = 300 Score = 58.9 bits (141), Expect = 2e-07 Identities = 25/39 (64%), Positives = 30/39 (76%) Frame = +2 Query: 350 MHGQDLSYWDAIDANIEAHLKKSIPIRPPIQVFEPMHHL 466 M Q+ SYW A++ I++HLKKSI IRPP VFEPMHHL Sbjct: 38 MEQQNKSYWAAVETQIDSHLKKSITIRPPTSVFEPMHHL 76 >ALT07955.1 putative geranyl diphosphate synthase small subunit type I [Leucosceptrum canum] Length = 302 Score = 57.8 bits (138), Expect = 5e-07 Identities = 24/36 (66%), Positives = 30/36 (83%) Frame = +2 Query: 359 QDLSYWDAIDANIEAHLKKSIPIRPPIQVFEPMHHL 466 Q+ SYW +IDA I+ +LKK++PIRPP VFEPMHHL Sbjct: 36 QNQSYWASIDAEIDTYLKKALPIRPPESVFEPMHHL 71 >XP_002532570.1 PREDICTED: heterodimeric geranylgeranyl pyrophosphate synthase small subunit, chloroplastic [Ricinus communis] EEF29831.1 geranyl geranyl pyrophosphate synthase, putative [Ricinus communis] Length = 308 Score = 57.8 bits (138), Expect = 6e-07 Identities = 22/34 (64%), Positives = 29/34 (85%) Frame = +2 Query: 365 LSYWDAIDANIEAHLKKSIPIRPPIQVFEPMHHL 466 + YW I+A+IE HLK++IP+RPP+ VFEPMHHL Sbjct: 46 IDYWTCINADIETHLKEAIPVRPPVVVFEPMHHL 79 >XP_012070840.1 PREDICTED: heterodimeric geranylgeranyl pyrophosphate synthase small subunit, chloroplastic-like [Jatropha curcas] KDP39141.1 hypothetical protein JCGZ_00898 [Jatropha curcas] Length = 313 Score = 57.8 bits (138), Expect = 6e-07 Identities = 23/33 (69%), Positives = 30/33 (90%) Frame = +2 Query: 368 SYWDAIDANIEAHLKKSIPIRPPIQVFEPMHHL 466 SYW +I+A+I+ HLK++IPIRPP+ VFEPMHHL Sbjct: 47 SYWTSINADIDTHLKQAIPIRPPLVVFEPMHHL 79 >XP_019231006.1 PREDICTED: heterodimeric geranylgeranyl pyrophosphate synthase small subunit, chloroplastic-like [Nicotiana attenuata] Length = 270 Score = 57.0 bits (136), Expect = 9e-07 Identities = 25/37 (67%), Positives = 30/37 (81%) Frame = +2 Query: 356 GQDLSYWDAIDANIEAHLKKSIPIRPPIQVFEPMHHL 466 G+D SYW +I++ IEAHLKK I IRPP VFEPMH+L Sbjct: 2 GRDQSYWASIESEIEAHLKKVISIRPPESVFEPMHYL 38 >OIT29044.1 heterodimeric geranylgeranyl pyrophosphate synthase small subunit, chloroplastic [Nicotiana attenuata] Length = 302 Score = 57.0 bits (136), Expect = 1e-06 Identities = 25/37 (67%), Positives = 30/37 (81%) Frame = +2 Query: 356 GQDLSYWDAIDANIEAHLKKSIPIRPPIQVFEPMHHL 466 G+D SYW +I++ IEAHLKK I IRPP VFEPMH+L Sbjct: 34 GRDQSYWASIESEIEAHLKKVISIRPPESVFEPMHYL 70 >XP_002322072.2 hypothetical protein POPTR_0015s04050g [Populus trichocarpa] EEF06199.2 hypothetical protein POPTR_0015s04050g [Populus trichocarpa] Length = 312 Score = 57.0 bits (136), Expect = 1e-06 Identities = 22/33 (66%), Positives = 29/33 (87%) Frame = +2 Query: 368 SYWDAIDANIEAHLKKSIPIRPPIQVFEPMHHL 466 SYW +++ I+AHLK++IPIRPP+ VFEPMHHL Sbjct: 51 SYWTSVNDEIDAHLKQAIPIRPPLSVFEPMHHL 83 >XP_011007747.1 PREDICTED: heterodimeric geranylgeranyl pyrophosphate synthase small subunit, chloroplastic-like [Populus euphratica] Length = 312 Score = 56.2 bits (134), Expect = 2e-06 Identities = 22/33 (66%), Positives = 29/33 (87%) Frame = +2 Query: 368 SYWDAIDANIEAHLKKSIPIRPPIQVFEPMHHL 466 SYW +++ I+AHLK++IPIRPP+ VFEPMHHL Sbjct: 51 SYWTSVNDEIDAHLKQAIPIRPPLLVFEPMHHL 83 >AGH33891.1 geranyl diphsophate synthase small subunit [Lavandula x intermedia] Length = 295 Score = 55.8 bits (133), Expect = 3e-06 Identities = 24/36 (66%), Positives = 29/36 (80%) Frame = +2 Query: 359 QDLSYWDAIDANIEAHLKKSIPIRPPIQVFEPMHHL 466 Q+ SYW +IDA+I +LKK+IPIR P VFEPMHHL Sbjct: 28 QNASYWSSIDADINTYLKKAIPIRSPETVFEPMHHL 63 >XP_018811644.1 PREDICTED: heterodimeric geranylgeranyl pyrophosphate synthase small subunit, chloroplastic-like [Juglans regia] Length = 299 Score = 55.8 bits (133), Expect = 3e-06 Identities = 22/33 (66%), Positives = 29/33 (87%) Frame = +2 Query: 368 SYWDAIDANIEAHLKKSIPIRPPIQVFEPMHHL 466 SYW +I+ IEAHLK++IP+RPP++VFEPM HL Sbjct: 44 SYWTSINGEIEAHLKQAIPLRPPLEVFEPMSHL 76 >XP_019196842.1 PREDICTED: heterodimeric geranylgeranyl pyrophosphate synthase small subunit, chloroplastic-like [Ipomoea nil] Length = 283 Score = 55.1 bits (131), Expect = 5e-06 Identities = 22/39 (56%), Positives = 32/39 (82%) Frame = +2 Query: 350 MHGQDLSYWDAIDANIEAHLKKSIPIRPPIQVFEPMHHL 466 M ++ SYW +I+A+IEAHLKK++P+RPP VFEP+ +L Sbjct: 34 MVAENQSYWASIEADIEAHLKKALPVRPPASVFEPLRYL 72 >XP_012460748.1 PREDICTED: heterodimeric geranylgeranyl pyrophosphate synthase small subunit, chloroplastic-like [Gossypium raimondii] KJB13693.1 hypothetical protein B456_002G089600 [Gossypium raimondii] Length = 296 Score = 55.1 bits (131), Expect = 5e-06 Identities = 22/33 (66%), Positives = 30/33 (90%) Frame = +2 Query: 368 SYWDAIDANIEAHLKKSIPIRPPIQVFEPMHHL 466 SYW +I+A+IEAHLK++IP+R P+ VFEPM+HL Sbjct: 44 SYWTSINADIEAHLKQAIPVREPLSVFEPMNHL 76 >GAV72912.1 polyprenyl_synt domain-containing protein [Cephalotus follicularis] Length = 300 Score = 55.1 bits (131), Expect = 5e-06 Identities = 20/33 (60%), Positives = 29/33 (87%) Frame = +2 Query: 368 SYWDAIDANIEAHLKKSIPIRPPIQVFEPMHHL 466 SYWD+I A++E HL+++I +RPP+ V+EPMHHL Sbjct: 45 SYWDSIHADVETHLREAIHVRPPLSVYEPMHHL 77 >XP_015081852.1 PREDICTED: heterodimeric geranylgeranyl pyrophosphate synthase small subunit, chloroplastic-like [Solanum pennellii] Length = 315 Score = 55.1 bits (131), Expect = 5e-06 Identities = 24/37 (64%), Positives = 31/37 (83%) Frame = +2 Query: 356 GQDLSYWDAIDANIEAHLKKSIPIRPPIQVFEPMHHL 466 GQ+ SYW +I+++IEAHLKK+I IR P VFEPMH+L Sbjct: 26 GQNQSYWASIESDIEAHLKKAISIRAPESVFEPMHYL 62 >XP_010324311.1 PREDICTED: heterodimeric geranylgeranyl pyrophosphate synthase small subunit, chloroplastic-like [Solanum lycopersicum] Length = 315 Score = 55.1 bits (131), Expect = 5e-06 Identities = 24/37 (64%), Positives = 31/37 (83%) Frame = +2 Query: 356 GQDLSYWDAIDANIEAHLKKSIPIRPPIQVFEPMHHL 466 GQ+ SYW +I+++IEAHLKK+I IR P VFEPMH+L Sbjct: 26 GQNQSYWASIESDIEAHLKKAISIRAPESVFEPMHYL 62 >XP_011095406.1 PREDICTED: heterodimeric geranylgeranyl pyrophosphate synthase small subunit, chloroplastic-like [Sesamum indicum] Length = 290 Score = 54.7 bits (130), Expect = 6e-06 Identities = 24/33 (72%), Positives = 27/33 (81%) Frame = +2 Query: 368 SYWDAIDANIEAHLKKSIPIRPPIQVFEPMHHL 466 SYW +IDA I+A+L KSIPIR P VFEPMHHL Sbjct: 43 SYWASIDAQIDAYLNKSIPIRSPESVFEPMHHL 75 >XP_007214528.1 hypothetical protein PRUPE_ppa015010mg [Prunus persica] ONI13318.1 hypothetical protein PRUPE_4G215000 [Prunus persica] Length = 296 Score = 54.3 bits (129), Expect = 9e-06 Identities = 23/43 (53%), Positives = 30/43 (69%) Frame = +2 Query: 338 STNFMHGQDLSYWDAIDANIEAHLKKSIPIRPPIQVFEPMHHL 466 +T + QD YW ++ A IE HLK+ I +RPP+ VFEPMHHL Sbjct: 29 TTMAIMSQDHPYWASVHAEIEVHLKQHILVRPPLSVFEPMHHL 71