BLASTX nr result
ID: Panax24_contig00040197
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00040197 (384 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017184629.1 PREDICTED: transcription repressor MYB6-like [Mal... 73 2e-14 XP_018814835.1 PREDICTED: transcription repressor MYB6-like, par... 73 2e-14 XP_010259378.1 PREDICTED: transcription repressor MYB4-like [Nel... 76 3e-14 XP_010044170.1 PREDICTED: transcription repressor MYB4 [Eucalypt... 75 5e-14 AKG50133.1 transcription repressor MybC2-L1, partial [Betula lum... 75 6e-14 XP_018860515.1 PREDICTED: transcription repressor MYB6-like, par... 73 6e-14 GAV84590.1 Myb_DNA-binding domain-containing protein [Cephalotus... 75 6e-14 ALP43794.1 transcription factor MYB4, partial [Vaccinium corymbo... 75 7e-14 XP_012072198.1 PREDICTED: transcription repressor MYB4 isoform X... 75 7e-14 XP_002315890.2 hypothetical protein POPTR_0010s12420g [Populus t... 75 7e-14 XP_011038671.1 PREDICTED: transcription repressor MYB6-like [Pop... 75 7e-14 XP_007208617.1 hypothetical protein PRUPE_ppa021145mg, partial [... 71 8e-14 XP_004297358.1 PREDICTED: transcription repressor MYB6-like [Fra... 75 8e-14 XP_012479075.1 PREDICTED: transcription repressor MYB4-like [Gos... 74 9e-14 ONI03625.1 hypothetical protein PRUPE_6G270000 [Prunus persica] 71 9e-14 XP_016693253.1 PREDICTED: transcription repressor MYB4-like [Gos... 74 9e-14 XP_016665889.1 PREDICTED: transcription repressor MYB4-like [Gos... 74 9e-14 XP_017632362.1 PREDICTED: transcription repressor MYB4-like [Gos... 74 9e-14 ALP43795.1 transcription factor MYB21, partial [Vaccinium corymb... 74 1e-13 AKR80571.1 R2R3 MYB transcription factor [Vaccinium uliginosum] 74 1e-13 >XP_017184629.1 PREDICTED: transcription repressor MYB6-like [Malus domestica] Length = 109 Score = 73.2 bits (178), Expect = 2e-14 Identities = 32/37 (86%), Positives = 33/37 (89%) Frame = +2 Query: 272 GAWSKEEDEKLRDYIRTHGEGCWRTLPLAAGLLRCGK 382 GAWSK+ED KL DYIR HGEGCWRTLP AAGLLRCGK Sbjct: 14 GAWSKQEDLKLIDYIRKHGEGCWRTLPQAAGLLRCGK 50 >XP_018814835.1 PREDICTED: transcription repressor MYB6-like, partial [Juglans regia] Length = 110 Score = 73.2 bits (178), Expect = 2e-14 Identities = 31/37 (83%), Positives = 33/37 (89%) Frame = +2 Query: 272 GAWSKEEDEKLRDYIRTHGEGCWRTLPLAAGLLRCGK 382 GAWSK+ED+KL DYI HGEGCWRTLP AAGLLRCGK Sbjct: 14 GAWSKQEDQKLMDYILKHGEGCWRTLPQAAGLLRCGK 50 >XP_010259378.1 PREDICTED: transcription repressor MYB4-like [Nelumbo nucifera] Length = 232 Score = 75.9 bits (185), Expect = 3e-14 Identities = 32/37 (86%), Positives = 35/37 (94%) Frame = +2 Query: 272 GAWSKEEDEKLRDYIRTHGEGCWRTLPLAAGLLRCGK 382 GAWSK+ED+KL DYIRTHGEGCWR+LP AAGLLRCGK Sbjct: 14 GAWSKQEDQKLIDYIRTHGEGCWRSLPQAAGLLRCGK 50 >XP_010044170.1 PREDICTED: transcription repressor MYB4 [Eucalyptus grandis] KCW86207.1 hypothetical protein EUGRSUZ_B02896 [Eucalyptus grandis] Length = 229 Score = 75.1 bits (183), Expect = 5e-14 Identities = 32/37 (86%), Positives = 34/37 (91%) Frame = +2 Query: 272 GAWSKEEDEKLRDYIRTHGEGCWRTLPLAAGLLRCGK 382 GAWSK+ED+KL DYIR HGEGCWRTLP AAGLLRCGK Sbjct: 14 GAWSKQEDQKLIDYIRKHGEGCWRTLPKAAGLLRCGK 50 >AKG50133.1 transcription repressor MybC2-L1, partial [Betula luminifera] Length = 232 Score = 75.1 bits (183), Expect = 6e-14 Identities = 32/37 (86%), Positives = 34/37 (91%) Frame = +2 Query: 272 GAWSKEEDEKLRDYIRTHGEGCWRTLPLAAGLLRCGK 382 GAWSK+ED+KL DYIR HGEGCWRTLP AAGLLRCGK Sbjct: 14 GAWSKQEDQKLIDYIRKHGEGCWRTLPQAAGLLRCGK 50 >XP_018860515.1 PREDICTED: transcription repressor MYB6-like, partial [Juglans regia] Length = 148 Score = 73.2 bits (178), Expect = 6e-14 Identities = 31/37 (83%), Positives = 33/37 (89%) Frame = +2 Query: 272 GAWSKEEDEKLRDYIRTHGEGCWRTLPLAAGLLRCGK 382 GAWSK+ED+KL DYI HGEGCWRTLP AAGLLRCGK Sbjct: 14 GAWSKQEDQKLMDYILKHGEGCWRTLPQAAGLLRCGK 50 >GAV84590.1 Myb_DNA-binding domain-containing protein [Cephalotus follicularis] Length = 240 Score = 75.1 bits (183), Expect = 6e-14 Identities = 32/37 (86%), Positives = 34/37 (91%) Frame = +2 Query: 272 GAWSKEEDEKLRDYIRTHGEGCWRTLPLAAGLLRCGK 382 GAWSK+ED+KL DYIR HGEGCWRTLP AAGLLRCGK Sbjct: 14 GAWSKQEDQKLIDYIRKHGEGCWRTLPQAAGLLRCGK 50 >ALP43794.1 transcription factor MYB4, partial [Vaccinium corymbosum] Length = 220 Score = 74.7 bits (182), Expect = 7e-14 Identities = 31/37 (83%), Positives = 34/37 (91%) Frame = +2 Query: 272 GAWSKEEDEKLRDYIRTHGEGCWRTLPLAAGLLRCGK 382 GAW+K+ED+KL DYIRTHGEGCWRTLP AAGL RCGK Sbjct: 14 GAWTKQEDQKLIDYIRTHGEGCWRTLPKAAGLFRCGK 50 >XP_012072198.1 PREDICTED: transcription repressor MYB4 isoform X2 [Jatropha curcas] Length = 246 Score = 75.1 bits (183), Expect = 7e-14 Identities = 32/37 (86%), Positives = 34/37 (91%) Frame = +2 Query: 272 GAWSKEEDEKLRDYIRTHGEGCWRTLPLAAGLLRCGK 382 GAWSK+ED+KL DYIR HGEGCWRTLP AAGLLRCGK Sbjct: 14 GAWSKQEDQKLIDYIRKHGEGCWRTLPQAAGLLRCGK 50 >XP_002315890.2 hypothetical protein POPTR_0010s12420g [Populus trichocarpa] EEF02061.2 hypothetical protein POPTR_0010s12420g [Populus trichocarpa] Length = 226 Score = 74.7 bits (182), Expect = 7e-14 Identities = 32/37 (86%), Positives = 34/37 (91%) Frame = +2 Query: 272 GAWSKEEDEKLRDYIRTHGEGCWRTLPLAAGLLRCGK 382 GAWSKEED+KL DYIR HGEGCWR+LP AAGLLRCGK Sbjct: 14 GAWSKEEDQKLIDYIRKHGEGCWRSLPQAAGLLRCGK 50 >XP_011038671.1 PREDICTED: transcription repressor MYB6-like [Populus euphratica] Length = 228 Score = 74.7 bits (182), Expect = 7e-14 Identities = 32/37 (86%), Positives = 34/37 (91%) Frame = +2 Query: 272 GAWSKEEDEKLRDYIRTHGEGCWRTLPLAAGLLRCGK 382 GAWSKEED+KL DYIR HGEGCWR+LP AAGLLRCGK Sbjct: 14 GAWSKEEDQKLIDYIRKHGEGCWRSLPQAAGLLRCGK 50 >XP_007208617.1 hypothetical protein PRUPE_ppa021145mg, partial [Prunus persica] Length = 87 Score = 71.2 bits (173), Expect = 8e-14 Identities = 29/37 (78%), Positives = 34/37 (91%) Frame = +2 Query: 272 GAWSKEEDEKLRDYIRTHGEGCWRTLPLAAGLLRCGK 382 GAW+KEED++L DYIR HG+GCWR+LP AAGLLRCGK Sbjct: 15 GAWTKEEDQRLIDYIRVHGKGCWRSLPKAAGLLRCGK 51 >XP_004297358.1 PREDICTED: transcription repressor MYB6-like [Fragaria vesca subsp. vesca] Length = 255 Score = 75.1 bits (183), Expect = 8e-14 Identities = 32/37 (86%), Positives = 34/37 (91%) Frame = +2 Query: 272 GAWSKEEDEKLRDYIRTHGEGCWRTLPLAAGLLRCGK 382 GAWSK+ED+KL DYIR HGEGCWRTLP AAGLLRCGK Sbjct: 14 GAWSKQEDQKLIDYIRKHGEGCWRTLPQAAGLLRCGK 50 >XP_012479075.1 PREDICTED: transcription repressor MYB4-like [Gossypium raimondii] KJB30829.1 hypothetical protein B456_005G162600 [Gossypium raimondii] Length = 216 Score = 74.3 bits (181), Expect = 9e-14 Identities = 32/37 (86%), Positives = 34/37 (91%) Frame = +2 Query: 272 GAWSKEEDEKLRDYIRTHGEGCWRTLPLAAGLLRCGK 382 GAWSK+EDEKL +YIR HGEGCWRTLP AAGLLRCGK Sbjct: 14 GAWSKQEDEKLINYIRLHGEGCWRTLPQAAGLLRCGK 50 >ONI03625.1 hypothetical protein PRUPE_6G270000 [Prunus persica] Length = 92 Score = 71.2 bits (173), Expect = 9e-14 Identities = 29/37 (78%), Positives = 34/37 (91%) Frame = +2 Query: 272 GAWSKEEDEKLRDYIRTHGEGCWRTLPLAAGLLRCGK 382 GAW+KEED++L DYIR HG+GCWR+LP AAGLLRCGK Sbjct: 15 GAWTKEEDQRLIDYIRVHGKGCWRSLPKAAGLLRCGK 51 >XP_016693253.1 PREDICTED: transcription repressor MYB4-like [Gossypium hirsutum] Length = 221 Score = 74.3 bits (181), Expect = 9e-14 Identities = 32/37 (86%), Positives = 34/37 (91%) Frame = +2 Query: 272 GAWSKEEDEKLRDYIRTHGEGCWRTLPLAAGLLRCGK 382 GAWSK+EDEKL +YIR HGEGCWRTLP AAGLLRCGK Sbjct: 14 GAWSKQEDEKLINYIRIHGEGCWRTLPQAAGLLRCGK 50 >XP_016665889.1 PREDICTED: transcription repressor MYB4-like [Gossypium hirsutum] Length = 221 Score = 74.3 bits (181), Expect = 9e-14 Identities = 32/37 (86%), Positives = 34/37 (91%) Frame = +2 Query: 272 GAWSKEEDEKLRDYIRTHGEGCWRTLPLAAGLLRCGK 382 GAWSK+EDEKL +YIR HGEGCWRTLP AAGLLRCGK Sbjct: 14 GAWSKQEDEKLINYIRIHGEGCWRTLPQAAGLLRCGK 50 >XP_017632362.1 PREDICTED: transcription repressor MYB4-like [Gossypium arboreum] KHG19549.1 Transcription repressor MYB4 -like protein [Gossypium arboreum] Length = 221 Score = 74.3 bits (181), Expect = 9e-14 Identities = 32/37 (86%), Positives = 34/37 (91%) Frame = +2 Query: 272 GAWSKEEDEKLRDYIRTHGEGCWRTLPLAAGLLRCGK 382 GAWSK+EDEKL +YIR HGEGCWRTLP AAGLLRCGK Sbjct: 14 GAWSKQEDEKLINYIRIHGEGCWRTLPQAAGLLRCGK 50 >ALP43795.1 transcription factor MYB21, partial [Vaccinium corymbosum] Length = 232 Score = 74.3 bits (181), Expect = 1e-13 Identities = 31/37 (83%), Positives = 34/37 (91%) Frame = +2 Query: 272 GAWSKEEDEKLRDYIRTHGEGCWRTLPLAAGLLRCGK 382 GAWSK+ED+KL DYIR HGEGCWRT+P AAGLLRCGK Sbjct: 14 GAWSKQEDQKLIDYIRRHGEGCWRTIPQAAGLLRCGK 50 >AKR80571.1 R2R3 MYB transcription factor [Vaccinium uliginosum] Length = 233 Score = 74.3 bits (181), Expect = 1e-13 Identities = 31/37 (83%), Positives = 34/37 (91%) Frame = +2 Query: 272 GAWSKEEDEKLRDYIRTHGEGCWRTLPLAAGLLRCGK 382 GAWSK+ED+KL DYIR HGEGCWRT+P AAGLLRCGK Sbjct: 14 GAWSKQEDQKLIDYIRRHGEGCWRTIPQAAGLLRCGK 50