BLASTX nr result
ID: Panax24_contig00040126
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00040126 (496 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value OIW19359.1 hypothetical protein TanjilG_03493 [Lupinus angustifo... 55 6e-06 >OIW19359.1 hypothetical protein TanjilG_03493 [Lupinus angustifolius] Length = 718 Score = 55.5 bits (132), Expect = 6e-06 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -1 Query: 496 SNDDKVSLLLKESFIESFSNRDRAFMRVCILSFLYGIC 383 SNDDKVSLLLKESFI SF NRDR FM+V LS + +C Sbjct: 681 SNDDKVSLLLKESFIHSFPNRDRPFMKVYFLSLHHTLC 718