BLASTX nr result
ID: Panax24_contig00040096
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00040096 (444 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017238411.1 PREDICTED: uncharacterized protein At1g04910 [Dau... 68 1e-10 >XP_017238411.1 PREDICTED: uncharacterized protein At1g04910 [Daucus carota subsp. sativus] KZN02251.1 hypothetical protein DCAR_011005 [Daucus carota subsp. sativus] Length = 507 Score = 68.2 bits (165), Expect = 1e-10 Identities = 35/48 (72%), Positives = 39/48 (81%) Frame = -3 Query: 145 MCKLDEKCESTEEREKQWKIGMKFEGEIKEERQNLMVSHARMLLWIVR 2 MCKLDEK EE+EK+ +I MKF GEI EERQNLM+SHAR LLWIVR Sbjct: 1 MCKLDEK---REEKEKERRIIMKFVGEIHEERQNLMISHARTLLWIVR 45