BLASTX nr result
ID: Panax24_contig00040024
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00040024 (539 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017219630.1 PREDICTED: DUF21 domain-containing protein At2g14... 62 5e-11 KZM88751.1 hypothetical protein DCAR_025826 [Daucus carota subsp... 62 5e-11 XP_018816447.1 PREDICTED: DUF21 domain-containing protein At2g14... 51 9e-06 XP_018816448.1 PREDICTED: DUF21 domain-containing protein At2g14... 51 9e-06 >XP_017219630.1 PREDICTED: DUF21 domain-containing protein At2g14520-like [Daucus carota subsp. sativus] Length = 454 Score = 61.6 bits (148), Expect(2) = 5e-11 Identities = 30/38 (78%), Positives = 33/38 (86%) Frame = +1 Query: 364 RTSESMPLYDILNEFQKGLSHIALVLRQRSKMVKISTN 477 R SE MPLYDILNEFQ+GLSHIALVLR RS+M + STN Sbjct: 295 RISEKMPLYDILNEFQEGLSHIALVLRHRSEMAEHSTN 332 Score = 32.7 bits (73), Expect(2) = 5e-11 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +2 Query: 482 REVRLNICGECHPQNMGLR 538 REVRLNI GE H QN+GLR Sbjct: 334 REVRLNIYGEGHHQNLGLR 352 >KZM88751.1 hypothetical protein DCAR_025826 [Daucus carota subsp. sativus] Length = 427 Score = 61.6 bits (148), Expect(2) = 5e-11 Identities = 30/38 (78%), Positives = 33/38 (86%) Frame = +1 Query: 364 RTSESMPLYDILNEFQKGLSHIALVLRQRSKMVKISTN 477 R SE MPLYDILNEFQ+GLSHIALVLR RS+M + STN Sbjct: 268 RISEKMPLYDILNEFQEGLSHIALVLRHRSEMAEHSTN 305 Score = 32.7 bits (73), Expect(2) = 5e-11 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +2 Query: 482 REVRLNICGECHPQNMGLR 538 REVRLNI GE H QN+GLR Sbjct: 307 REVRLNIYGEGHHQNLGLR 325 >XP_018816447.1 PREDICTED: DUF21 domain-containing protein At2g14520-like isoform X1 [Juglans regia] Length = 422 Score = 51.2 bits (121), Expect(2) = 9e-06 Identities = 23/37 (62%), Positives = 31/37 (83%) Frame = +1 Query: 364 RTSESMPLYDILNEFQKGLSHIALVLRQRSKMVKIST 474 R SE+MPLYDILNEFQKG SH+A+V+R+ S + + +T Sbjct: 281 RVSETMPLYDILNEFQKGHSHMAVVVREHSDIAQSAT 317 Score = 25.4 bits (54), Expect(2) = 9e-06 Identities = 11/20 (55%), Positives = 15/20 (75%) Frame = +2 Query: 479 VREVRLNICGECHPQNMGLR 538 VR+VRL++ GE HPQ L+ Sbjct: 323 VRDVRLDVHGERHPQEKILK 342 >XP_018816448.1 PREDICTED: DUF21 domain-containing protein At2g14520-like isoform X2 [Juglans regia] Length = 339 Score = 51.2 bits (121), Expect(2) = 9e-06 Identities = 23/37 (62%), Positives = 31/37 (83%) Frame = +1 Query: 364 RTSESMPLYDILNEFQKGLSHIALVLRQRSKMVKIST 474 R SE+MPLYDILNEFQKG SH+A+V+R+ S + + +T Sbjct: 198 RVSETMPLYDILNEFQKGHSHMAVVVREHSDIAQSAT 234 Score = 25.4 bits (54), Expect(2) = 9e-06 Identities = 11/20 (55%), Positives = 15/20 (75%) Frame = +2 Query: 479 VREVRLNICGECHPQNMGLR 538 VR+VRL++ GE HPQ L+ Sbjct: 240 VRDVRLDVHGERHPQEKILK 259