BLASTX nr result
ID: Panax24_contig00039940
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00039940 (516 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KOX72607.1 hypothetical protein WN51_01820 [Melipona quadrifasci... 52 4e-06 >KOX72607.1 hypothetical protein WN51_01820 [Melipona quadrifasciata] Length = 53 Score = 51.6 bits (122), Expect = 4e-06 Identities = 20/44 (45%), Positives = 29/44 (65%) Frame = +1 Query: 16 KIYTQSYIYTYLMVYINLYIHCPKELYVYTIIHTYAHVYLSDRV 147 + Y +YI+TY+ YI+ YIH Y++T IHTY H+Y+ RV Sbjct: 4 RTYVHTYIHTYIHTYIHTYIHTYIHTYIHTYIHTYIHIYIHTRV 47