BLASTX nr result
ID: Panax24_contig00039466
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00039466 (476 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_009127879.1 PREDICTED: cyclic nucleotide-gated ion channel 17... 59 8e-12 KJB76591.1 hypothetical protein B456_012G095800 [Gossypium raimo... 56 1e-11 XP_012459404.1 PREDICTED: probable cyclic nucleotide-gated ion c... 56 1e-11 XP_013670810.1 PREDICTED: probable cyclic nucleotide-gated ion c... 57 2e-11 XP_006412715.1 hypothetical protein EUTSA_v10024525mg [Eutrema s... 57 2e-11 XP_013688788.1 PREDICTED: probable cyclic nucleotide-gated ion c... 57 2e-11 JAU87562.1 putative cyclic nucleotide-gated ion channel 17 [Nocc... 57 2e-11 JAU52269.1 putative cyclic nucleotide-gated ion channel 17 [Nocc... 57 2e-11 JAU19287.1 putative cyclic nucleotide-gated ion channel 17 [Nocc... 57 2e-11 XP_013600763.1 PREDICTED: probable cyclic nucleotide-gated ion c... 57 2e-11 CAB81029.1 cyclic nucleotide and calmodulin-regulated ion channe... 57 2e-11 XP_018471546.1 PREDICTED: cyclic nucleotide-gated ion channel 17... 57 2e-11 KFK29609.1 hypothetical protein AALP_AA7G156300 [Arabis alpina] 57 2e-11 NP_194765.2 cyclic nucleotide-gated channel 17 [Arabidopsis thal... 57 2e-11 XP_002867353.1 ATCNGC17 [Arabidopsis lyrata subsp. lyrata] EFH43... 57 2e-11 CDX68651.1 BnaC01g08020D [Brassica napus] 57 2e-11 CDY28182.1 BnaA01g06670D [Brassica napus] 57 2e-11 JAU52992.1 putative cyclic nucleotide-gated ion channel 17, part... 57 2e-11 GAV77826.1 cNMP_binding domain-containing protein [Cephalotus fo... 56 3e-11 XP_010914081.1 PREDICTED: probable cyclic nucleotide-gated ion c... 55 3e-11 >XP_009127879.1 PREDICTED: cyclic nucleotide-gated ion channel 17 [Brassica rapa] Length = 728 Score = 58.9 bits (141), Expect(3) = 8e-12 Identities = 42/89 (47%), Positives = 48/89 (53%), Gaps = 1/89 (1%) Frame = -3 Query: 438 FQFYFIETCDF-SEELPS*ALLTKSTLYLPFQPEQ*EHYCLPEKRRQDGIIKVEAFALQA 262 F + DF EEL S ALL KSTL LP R +++VEAFAL+A Sbjct: 543 FNSIILRPGDFCGEELLSWALLPKSTLNLP-----------SSTRTVRALVEVEAFALRA 591 Query: 261 EVLKFLDYQFRRRVSKKLQHNL*FCSRHG 175 E LKF+ QFRR SKKLQH F S HG Sbjct: 592 EDLKFVANQFRRLHSKKLQHTFRFYSPHG 620 Score = 32.3 bits (72), Expect(3) = 8e-12 Identities = 17/22 (77%), Positives = 18/22 (81%), Gaps = 1/22 (4%) Frame = -1 Query: 476 RLESSTTKG-RTSFSNSILLRP 414 RLESSTT G RT F NSI+LRP Sbjct: 529 RLESSTTNGGRTGFFNSIILRP 550 Score = 25.4 bits (54), Expect(3) = 8e-12 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = -2 Query: 178 WVVCFIQAAW 149 W CFIQAAW Sbjct: 623 WAACFIQAAW 632 >KJB76591.1 hypothetical protein B456_012G095800 [Gossypium raimondii] Length = 738 Score = 55.8 bits (133), Expect(3) = 1e-11 Identities = 37/75 (49%), Positives = 43/75 (57%) Frame = -3 Query: 402 EELPS*ALLTKSTLYLPFQPEQ*EHYCLPEKRRQDGIIKVEAFALQAEVLKFLDYQFRRR 223 EEL + ALL KSTL LP R +++VEAFAL+AE LKF+ QFRR Sbjct: 571 EELLAWALLPKSTLNLP-----------SSTRTVRALVEVEAFALRAEDLKFVANQFRRL 619 Query: 222 VSKKLQHNL*FCSRH 178 SKKLQH F S H Sbjct: 620 HSKKLQHTFRFYSHH 634 Score = 32.0 bits (71), Expect(3) = 1e-11 Identities = 17/22 (77%), Positives = 18/22 (81%), Gaps = 1/22 (4%) Frame = -1 Query: 476 RLESSTTKG-RTSFSNSILLRP 414 RLESSTT G RT F NSI+LRP Sbjct: 544 RLESSTTNGGRTGFFNSIVLRP 565 Score = 28.5 bits (62), Expect(3) = 1e-11 Identities = 9/11 (81%), Positives = 9/11 (81%) Frame = -2 Query: 178 WVVCFIQAAWH 146 W CFIQAAWH Sbjct: 638 WAACFIQAAWH 648 >XP_012459404.1 PREDICTED: probable cyclic nucleotide-gated ion channel 17 [Gossypium raimondii] KJB76590.1 hypothetical protein B456_012G095800 [Gossypium raimondii] Length = 731 Score = 55.8 bits (133), Expect(3) = 1e-11 Identities = 37/75 (49%), Positives = 43/75 (57%) Frame = -3 Query: 402 EELPS*ALLTKSTLYLPFQPEQ*EHYCLPEKRRQDGIIKVEAFALQAEVLKFLDYQFRRR 223 EEL + ALL KSTL LP R +++VEAFAL+AE LKF+ QFRR Sbjct: 564 EELLAWALLPKSTLNLP-----------SSTRTVRALVEVEAFALRAEDLKFVANQFRRL 612 Query: 222 VSKKLQHNL*FCSRH 178 SKKLQH F S H Sbjct: 613 HSKKLQHTFRFYSHH 627 Score = 32.0 bits (71), Expect(3) = 1e-11 Identities = 17/22 (77%), Positives = 18/22 (81%), Gaps = 1/22 (4%) Frame = -1 Query: 476 RLESSTTKG-RTSFSNSILLRP 414 RLESSTT G RT F NSI+LRP Sbjct: 537 RLESSTTNGGRTGFFNSIVLRP 558 Score = 28.5 bits (62), Expect(3) = 1e-11 Identities = 9/11 (81%), Positives = 9/11 (81%) Frame = -2 Query: 178 WVVCFIQAAWH 146 W CFIQAAWH Sbjct: 631 WAACFIQAAWH 641 >XP_013670810.1 PREDICTED: probable cyclic nucleotide-gated ion channel 17 [Brassica napus] Length = 729 Score = 57.4 bits (137), Expect(3) = 2e-11 Identities = 41/88 (46%), Positives = 47/88 (53%), Gaps = 1/88 (1%) Frame = -3 Query: 438 FQFYFIETCDF-SEELPS*ALLTKSTLYLPFQPEQ*EHYCLPEKRRQDGIIKVEAFALQA 262 F + DF EEL S ALL KSTL LP R +++VEAFAL+A Sbjct: 543 FNSIILRPGDFCGEELLSWALLPKSTLNLP-----------SSTRTVRALVEVEAFALRA 591 Query: 261 EVLKFLDYQFRRRVSKKLQHNL*FCSRH 178 E LKF+ QFRR SKKLQH F S H Sbjct: 592 EDLKFVANQFRRLHSKKLQHTFRFYSHH 619 Score = 32.3 bits (72), Expect(3) = 2e-11 Identities = 17/22 (77%), Positives = 18/22 (81%), Gaps = 1/22 (4%) Frame = -1 Query: 476 RLESSTTKG-RTSFSNSILLRP 414 RLESSTT G RT F NSI+LRP Sbjct: 529 RLESSTTNGGRTGFFNSIILRP 550 Score = 25.4 bits (54), Expect(3) = 2e-11 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = -2 Query: 178 WVVCFIQAAW 149 W CFIQAAW Sbjct: 623 WAACFIQAAW 632 >XP_006412715.1 hypothetical protein EUTSA_v10024525mg [Eutrema salsugineum] ESQ54168.1 hypothetical protein EUTSA_v10024525mg [Eutrema salsugineum] Length = 729 Score = 57.4 bits (137), Expect(3) = 2e-11 Identities = 41/88 (46%), Positives = 47/88 (53%), Gaps = 1/88 (1%) Frame = -3 Query: 438 FQFYFIETCDF-SEELPS*ALLTKSTLYLPFQPEQ*EHYCLPEKRRQDGIIKVEAFALQA 262 F + DF EEL S ALL KSTL LP R +++VEAFAL+A Sbjct: 544 FNSIILRPGDFCGEELLSWALLPKSTLNLP-----------SSTRTVRALVEVEAFALRA 592 Query: 261 EVLKFLDYQFRRRVSKKLQHNL*FCSRH 178 E LKF+ QFRR SKKLQH F S H Sbjct: 593 EDLKFVANQFRRLHSKKLQHTFRFYSHH 620 Score = 32.3 bits (72), Expect(3) = 2e-11 Identities = 17/22 (77%), Positives = 18/22 (81%), Gaps = 1/22 (4%) Frame = -1 Query: 476 RLESSTTKG-RTSFSNSILLRP 414 RLESSTT G RT F NSI+LRP Sbjct: 530 RLESSTTNGGRTGFFNSIILRP 551 Score = 25.4 bits (54), Expect(3) = 2e-11 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = -2 Query: 178 WVVCFIQAAW 149 W CFIQAAW Sbjct: 624 WAACFIQAAW 633 >XP_013688788.1 PREDICTED: probable cyclic nucleotide-gated ion channel 17 [Brassica napus] Length = 728 Score = 57.4 bits (137), Expect(3) = 2e-11 Identities = 41/88 (46%), Positives = 47/88 (53%), Gaps = 1/88 (1%) Frame = -3 Query: 438 FQFYFIETCDF-SEELPS*ALLTKSTLYLPFQPEQ*EHYCLPEKRRQDGIIKVEAFALQA 262 F + DF EEL S ALL KSTL LP R +++VEAFAL+A Sbjct: 543 FNSIILRPGDFCGEELLSWALLPKSTLNLP-----------SSTRTVRALVEVEAFALRA 591 Query: 261 EVLKFLDYQFRRRVSKKLQHNL*FCSRH 178 E LKF+ QFRR SKKLQH F S H Sbjct: 592 EDLKFVANQFRRLHSKKLQHTFRFYSHH 619 Score = 32.3 bits (72), Expect(3) = 2e-11 Identities = 17/22 (77%), Positives = 18/22 (81%), Gaps = 1/22 (4%) Frame = -1 Query: 476 RLESSTTKG-RTSFSNSILLRP 414 RLESSTT G RT F NSI+LRP Sbjct: 529 RLESSTTNGGRTGFFNSIILRP 550 Score = 25.4 bits (54), Expect(3) = 2e-11 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = -2 Query: 178 WVVCFIQAAW 149 W CFIQAAW Sbjct: 623 WAACFIQAAW 632 >JAU87562.1 putative cyclic nucleotide-gated ion channel 17 [Noccaea caerulescens] Length = 727 Score = 57.4 bits (137), Expect(3) = 2e-11 Identities = 41/88 (46%), Positives = 47/88 (53%), Gaps = 1/88 (1%) Frame = -3 Query: 438 FQFYFIETCDF-SEELPS*ALLTKSTLYLPFQPEQ*EHYCLPEKRRQDGIIKVEAFALQA 262 F + DF EEL S ALL KSTL LP R +++VEAFAL+A Sbjct: 546 FNSIILRPGDFCGEELLSWALLPKSTLNLP-----------SSTRTVRALVEVEAFALRA 594 Query: 261 EVLKFLDYQFRRRVSKKLQHNL*FCSRH 178 E LKF+ QFRR SKKLQH F S H Sbjct: 595 EDLKFVANQFRRLHSKKLQHTFRFYSHH 622 Score = 32.3 bits (72), Expect(3) = 2e-11 Identities = 17/22 (77%), Positives = 18/22 (81%), Gaps = 1/22 (4%) Frame = -1 Query: 476 RLESSTTKG-RTSFSNSILLRP 414 RLESSTT G RT F NSI+LRP Sbjct: 532 RLESSTTNGGRTGFFNSIILRP 553 Score = 25.4 bits (54), Expect(3) = 2e-11 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = -2 Query: 178 WVVCFIQAAW 149 W CFIQAAW Sbjct: 626 WAACFIQAAW 635 >JAU52269.1 putative cyclic nucleotide-gated ion channel 17 [Noccaea caerulescens] Length = 727 Score = 57.4 bits (137), Expect(3) = 2e-11 Identities = 41/88 (46%), Positives = 47/88 (53%), Gaps = 1/88 (1%) Frame = -3 Query: 438 FQFYFIETCDF-SEELPS*ALLTKSTLYLPFQPEQ*EHYCLPEKRRQDGIIKVEAFALQA 262 F + DF EEL S ALL KSTL LP R +++VEAFAL+A Sbjct: 546 FNSIILRPGDFCGEELLSWALLPKSTLNLP-----------SSTRTVRALVEVEAFALRA 594 Query: 261 EVLKFLDYQFRRRVSKKLQHNL*FCSRH 178 E LKF+ QFRR SKKLQH F S H Sbjct: 595 EDLKFVANQFRRLHSKKLQHTFRFYSHH 622 Score = 32.3 bits (72), Expect(3) = 2e-11 Identities = 17/22 (77%), Positives = 18/22 (81%), Gaps = 1/22 (4%) Frame = -1 Query: 476 RLESSTTKG-RTSFSNSILLRP 414 RLESSTT G RT F NSI+LRP Sbjct: 532 RLESSTTNGGRTGFFNSIILRP 553 Score = 25.4 bits (54), Expect(3) = 2e-11 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = -2 Query: 178 WVVCFIQAAW 149 W CFIQAAW Sbjct: 626 WAACFIQAAW 635 >JAU19287.1 putative cyclic nucleotide-gated ion channel 17 [Noccaea caerulescens] Length = 727 Score = 57.4 bits (137), Expect(3) = 2e-11 Identities = 41/88 (46%), Positives = 47/88 (53%), Gaps = 1/88 (1%) Frame = -3 Query: 438 FQFYFIETCDF-SEELPS*ALLTKSTLYLPFQPEQ*EHYCLPEKRRQDGIIKVEAFALQA 262 F + DF EEL S ALL KSTL LP R +++VEAFAL+A Sbjct: 546 FNSIILRPGDFCGEELLSWALLPKSTLNLP-----------SSTRTVRALVEVEAFALRA 594 Query: 261 EVLKFLDYQFRRRVSKKLQHNL*FCSRH 178 E LKF+ QFRR SKKLQH F S H Sbjct: 595 EDLKFVANQFRRLHSKKLQHTFRFYSHH 622 Score = 32.3 bits (72), Expect(3) = 2e-11 Identities = 17/22 (77%), Positives = 18/22 (81%), Gaps = 1/22 (4%) Frame = -1 Query: 476 RLESSTTKG-RTSFSNSILLRP 414 RLESSTT G RT F NSI+LRP Sbjct: 532 RLESSTTNGGRTGFFNSIILRP 553 Score = 25.4 bits (54), Expect(3) = 2e-11 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = -2 Query: 178 WVVCFIQAAW 149 W CFIQAAW Sbjct: 626 WAACFIQAAW 635 >XP_013600763.1 PREDICTED: probable cyclic nucleotide-gated ion channel 17 [Brassica oleracea var. oleracea] Length = 727 Score = 57.4 bits (137), Expect(3) = 2e-11 Identities = 41/88 (46%), Positives = 47/88 (53%), Gaps = 1/88 (1%) Frame = -3 Query: 438 FQFYFIETCDF-SEELPS*ALLTKSTLYLPFQPEQ*EHYCLPEKRRQDGIIKVEAFALQA 262 F + DF EEL S ALL KSTL LP R +++VEAFAL+A Sbjct: 543 FNSIILRPGDFCGEELLSWALLPKSTLNLP-----------SSTRTVRALVEVEAFALRA 591 Query: 261 EVLKFLDYQFRRRVSKKLQHNL*FCSRH 178 E LKF+ QFRR SKKLQH F S H Sbjct: 592 EDLKFVANQFRRLHSKKLQHTFRFYSHH 619 Score = 32.3 bits (72), Expect(3) = 2e-11 Identities = 17/22 (77%), Positives = 18/22 (81%), Gaps = 1/22 (4%) Frame = -1 Query: 476 RLESSTTKG-RTSFSNSILLRP 414 RLESSTT G RT F NSI+LRP Sbjct: 529 RLESSTTNGGRTGFFNSIILRP 550 Score = 25.4 bits (54), Expect(3) = 2e-11 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = -2 Query: 178 WVVCFIQAAW 149 W CFIQAAW Sbjct: 623 WAACFIQAAW 632 >CAB81029.1 cyclic nucleotide and calmodulin-regulated ion channel-like protein [Arabidopsis thaliana] Length = 726 Score = 57.4 bits (137), Expect(3) = 2e-11 Identities = 41/88 (46%), Positives = 47/88 (53%), Gaps = 1/88 (1%) Frame = -3 Query: 438 FQFYFIETCDF-SEELPS*ALLTKSTLYLPFQPEQ*EHYCLPEKRRQDGIIKVEAFALQA 262 F + DF EEL S ALL KSTL LP R +++VEAFAL+A Sbjct: 545 FNSIILRPGDFCGEELLSWALLPKSTLNLP-----------SSTRTVRALVEVEAFALRA 593 Query: 261 EVLKFLDYQFRRRVSKKLQHNL*FCSRH 178 E LKF+ QFRR SKKLQH F S H Sbjct: 594 EDLKFVANQFRRLHSKKLQHTFRFYSHH 621 Score = 32.3 bits (72), Expect(3) = 2e-11 Identities = 17/22 (77%), Positives = 18/22 (81%), Gaps = 1/22 (4%) Frame = -1 Query: 476 RLESSTTKG-RTSFSNSILLRP 414 RLESSTT G RT F NSI+LRP Sbjct: 531 RLESSTTNGGRTGFFNSIILRP 552 Score = 25.4 bits (54), Expect(3) = 2e-11 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = -2 Query: 178 WVVCFIQAAW 149 W CFIQAAW Sbjct: 625 WAACFIQAAW 634 >XP_018471546.1 PREDICTED: cyclic nucleotide-gated ion channel 17 [Raphanus sativus] Length = 725 Score = 57.4 bits (137), Expect(3) = 2e-11 Identities = 41/88 (46%), Positives = 47/88 (53%), Gaps = 1/88 (1%) Frame = -3 Query: 438 FQFYFIETCDF-SEELPS*ALLTKSTLYLPFQPEQ*EHYCLPEKRRQDGIIKVEAFALQA 262 F + DF EEL S ALL KSTL LP R +++VEAFAL+A Sbjct: 542 FNSIILRPGDFCGEELLSWALLPKSTLNLP-----------SSTRTVRALVEVEAFALRA 590 Query: 261 EVLKFLDYQFRRRVSKKLQHNL*FCSRH 178 E LKF+ QFRR SKKLQH F S H Sbjct: 591 EDLKFVANQFRRLHSKKLQHTFRFYSHH 618 Score = 32.3 bits (72), Expect(3) = 2e-11 Identities = 17/22 (77%), Positives = 18/22 (81%), Gaps = 1/22 (4%) Frame = -1 Query: 476 RLESSTTKG-RTSFSNSILLRP 414 RLESSTT G RT F NSI+LRP Sbjct: 528 RLESSTTNGGRTGFFNSIILRP 549 Score = 25.4 bits (54), Expect(3) = 2e-11 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = -2 Query: 178 WVVCFIQAAW 149 W CFIQAAW Sbjct: 622 WAACFIQAAW 631 >KFK29609.1 hypothetical protein AALP_AA7G156300 [Arabis alpina] Length = 722 Score = 57.4 bits (137), Expect(3) = 2e-11 Identities = 41/88 (46%), Positives = 47/88 (53%), Gaps = 1/88 (1%) Frame = -3 Query: 438 FQFYFIETCDF-SEELPS*ALLTKSTLYLPFQPEQ*EHYCLPEKRRQDGIIKVEAFALQA 262 F + DF EEL S ALL KSTL LP R +++VEAFAL+A Sbjct: 546 FNSIILRPGDFCGEELLSWALLPKSTLNLP-----------SSTRTVRALVEVEAFALRA 594 Query: 261 EVLKFLDYQFRRRVSKKLQHNL*FCSRH 178 E LKF+ QFRR SKKLQH F S H Sbjct: 595 EDLKFVANQFRRLHSKKLQHTFRFYSHH 622 Score = 32.3 bits (72), Expect(3) = 2e-11 Identities = 17/22 (77%), Positives = 18/22 (81%), Gaps = 1/22 (4%) Frame = -1 Query: 476 RLESSTTKG-RTSFSNSILLRP 414 RLESSTT G RT F NSI+LRP Sbjct: 532 RLESSTTNGGRTGFFNSIILRP 553 Score = 25.4 bits (54), Expect(3) = 2e-11 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = -2 Query: 178 WVVCFIQAAW 149 W CFIQAAW Sbjct: 626 WAACFIQAAW 635 >NP_194765.2 cyclic nucleotide-gated channel 17 [Arabidopsis thaliana] Q8L7Z0.1 RecName: Full=Cyclic nucleotide-gated ion channel 17; AltName: Full=Cyclic nucleotide- and calmodulin-regulated ion channel 17 AAM74509.1 AT4g30360/F17I23_300 [Arabidopsis thaliana] AAN72295.1 At4g30360/F17I23_300 [Arabidopsis thaliana] BAE99216.1 cyclic nucleotide and calmodulin-regulated ion channel-like protein [Arabidopsis thaliana] AEE85756.1 cyclic nucleotide-gated channel 17 [Arabidopsis thaliana] OAP00456.1 CNGC17 [Arabidopsis thaliana] Length = 720 Score = 57.4 bits (137), Expect(3) = 2e-11 Identities = 41/88 (46%), Positives = 47/88 (53%), Gaps = 1/88 (1%) Frame = -3 Query: 438 FQFYFIETCDF-SEELPS*ALLTKSTLYLPFQPEQ*EHYCLPEKRRQDGIIKVEAFALQA 262 F + DF EEL S ALL KSTL LP R +++VEAFAL+A Sbjct: 539 FNSIILRPGDFCGEELLSWALLPKSTLNLP-----------SSTRTVRALVEVEAFALRA 587 Query: 261 EVLKFLDYQFRRRVSKKLQHNL*FCSRH 178 E LKF+ QFRR SKKLQH F S H Sbjct: 588 EDLKFVANQFRRLHSKKLQHTFRFYSHH 615 Score = 32.3 bits (72), Expect(3) = 2e-11 Identities = 17/22 (77%), Positives = 18/22 (81%), Gaps = 1/22 (4%) Frame = -1 Query: 476 RLESSTTKG-RTSFSNSILLRP 414 RLESSTT G RT F NSI+LRP Sbjct: 525 RLESSTTNGGRTGFFNSIILRP 546 Score = 25.4 bits (54), Expect(3) = 2e-11 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = -2 Query: 178 WVVCFIQAAW 149 W CFIQAAW Sbjct: 619 WAACFIQAAW 628 >XP_002867353.1 ATCNGC17 [Arabidopsis lyrata subsp. lyrata] EFH43612.1 ATCNGC17, partial [Arabidopsis lyrata subsp. lyrata] Length = 717 Score = 57.4 bits (137), Expect(3) = 2e-11 Identities = 41/88 (46%), Positives = 47/88 (53%), Gaps = 1/88 (1%) Frame = -3 Query: 438 FQFYFIETCDF-SEELPS*ALLTKSTLYLPFQPEQ*EHYCLPEKRRQDGIIKVEAFALQA 262 F + DF EEL S ALL KSTL LP R +++VEAFAL+A Sbjct: 537 FNSIILRPGDFCGEELLSWALLPKSTLNLP-----------SSTRTVRALVEVEAFALRA 585 Query: 261 EVLKFLDYQFRRRVSKKLQHNL*FCSRH 178 E LKF+ QFRR SKKLQH F S H Sbjct: 586 EDLKFVANQFRRLHSKKLQHTFRFYSHH 613 Score = 32.3 bits (72), Expect(3) = 2e-11 Identities = 17/22 (77%), Positives = 18/22 (81%), Gaps = 1/22 (4%) Frame = -1 Query: 476 RLESSTTKG-RTSFSNSILLRP 414 RLESSTT G RT F NSI+LRP Sbjct: 523 RLESSTTNGGRTGFFNSIILRP 544 Score = 25.4 bits (54), Expect(3) = 2e-11 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = -2 Query: 178 WVVCFIQAAW 149 W CFIQAAW Sbjct: 617 WAACFIQAAW 626 >CDX68651.1 BnaC01g08020D [Brassica napus] Length = 705 Score = 57.4 bits (137), Expect(3) = 2e-11 Identities = 41/88 (46%), Positives = 47/88 (53%), Gaps = 1/88 (1%) Frame = -3 Query: 438 FQFYFIETCDF-SEELPS*ALLTKSTLYLPFQPEQ*EHYCLPEKRRQDGIIKVEAFALQA 262 F + DF EEL S ALL KSTL LP R +++VEAFAL+A Sbjct: 542 FNSIILRPGDFCGEELLSWALLPKSTLNLP-----------SSTRTVRALVEVEAFALRA 590 Query: 261 EVLKFLDYQFRRRVSKKLQHNL*FCSRH 178 E LKF+ QFRR SKKLQH F S H Sbjct: 591 EDLKFVANQFRRLHSKKLQHTFRFYSHH 618 Score = 32.3 bits (72), Expect(3) = 2e-11 Identities = 17/22 (77%), Positives = 18/22 (81%), Gaps = 1/22 (4%) Frame = -1 Query: 476 RLESSTTKG-RTSFSNSILLRP 414 RLESSTT G RT F NSI+LRP Sbjct: 528 RLESSTTNGGRTGFFNSIILRP 549 Score = 25.4 bits (54), Expect(3) = 2e-11 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = -2 Query: 178 WVVCFIQAAW 149 W CFIQAAW Sbjct: 622 WAACFIQAAW 631 >CDY28182.1 BnaA01g06670D [Brassica napus] Length = 694 Score = 57.4 bits (137), Expect(3) = 2e-11 Identities = 41/88 (46%), Positives = 47/88 (53%), Gaps = 1/88 (1%) Frame = -3 Query: 438 FQFYFIETCDF-SEELPS*ALLTKSTLYLPFQPEQ*EHYCLPEKRRQDGIIKVEAFALQA 262 F + DF EEL S ALL KSTL LP R +++VEAFAL+A Sbjct: 543 FNSIILRPGDFCGEELLSWALLPKSTLNLP-----------SSTRTVRALVEVEAFALRA 591 Query: 261 EVLKFLDYQFRRRVSKKLQHNL*FCSRH 178 E LKF+ QFRR SKKLQH F S H Sbjct: 592 EDLKFVANQFRRLHSKKLQHTFRFYSHH 619 Score = 32.3 bits (72), Expect(3) = 2e-11 Identities = 17/22 (77%), Positives = 18/22 (81%), Gaps = 1/22 (4%) Frame = -1 Query: 476 RLESSTTKG-RTSFSNSILLRP 414 RLESSTT G RT F NSI+LRP Sbjct: 529 RLESSTTNGGRTGFFNSIILRP 550 Score = 25.4 bits (54), Expect(3) = 2e-11 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = -2 Query: 178 WVVCFIQAAW 149 W CFIQAAW Sbjct: 623 WAACFIQAAW 632 >JAU52992.1 putative cyclic nucleotide-gated ion channel 17, partial [Noccaea caerulescens] Length = 500 Score = 57.4 bits (137), Expect(3) = 2e-11 Identities = 41/88 (46%), Positives = 47/88 (53%), Gaps = 1/88 (1%) Frame = -3 Query: 438 FQFYFIETCDF-SEELPS*ALLTKSTLYLPFQPEQ*EHYCLPEKRRQDGIIKVEAFALQA 262 F + DF EEL S ALL KSTL LP R +++VEAFAL+A Sbjct: 319 FNSIILRPGDFCGEELLSWALLPKSTLNLP-----------SSTRTVRALVEVEAFALRA 367 Query: 261 EVLKFLDYQFRRRVSKKLQHNL*FCSRH 178 E LKF+ QFRR SKKLQH F S H Sbjct: 368 EDLKFVANQFRRLHSKKLQHTFRFYSHH 395 Score = 32.3 bits (72), Expect(3) = 2e-11 Identities = 17/22 (77%), Positives = 18/22 (81%), Gaps = 1/22 (4%) Frame = -1 Query: 476 RLESSTTKG-RTSFSNSILLRP 414 RLESSTT G RT F NSI+LRP Sbjct: 305 RLESSTTNGGRTGFFNSIILRP 326 Score = 25.4 bits (54), Expect(3) = 2e-11 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = -2 Query: 178 WVVCFIQAAW 149 W CFIQAAW Sbjct: 399 WAACFIQAAW 408 >GAV77826.1 cNMP_binding domain-containing protein [Cephalotus follicularis] Length = 728 Score = 56.2 bits (134), Expect(3) = 3e-11 Identities = 40/88 (45%), Positives = 47/88 (53%), Gaps = 1/88 (1%) Frame = -3 Query: 438 FQFYFIETCDF-SEELPS*ALLTKSTLYLPFQPEQ*EHYCLPEKRRQDGIIKVEAFALQA 262 F + DF EEL S ALL KS+L LP R +++VEAFAL+A Sbjct: 551 FNSIILRPGDFCGEELLSWALLPKSSLNLP-----------SSTRTVKALVEVEAFALRA 599 Query: 261 EVLKFLDYQFRRRVSKKLQHNL*FCSRH 178 E LKF+ QFRR SKKLQH F S H Sbjct: 600 EDLKFVANQFRRLHSKKLQHTFRFYSHH 627 Score = 30.0 bits (66), Expect(3) = 3e-11 Identities = 15/22 (68%), Positives = 18/22 (81%), Gaps = 1/22 (4%) Frame = -1 Query: 476 RLESSTTKG-RTSFSNSILLRP 414 +L+SSTT G RT F NSI+LRP Sbjct: 537 KLDSSTTNGGRTGFFNSIILRP 558 Score = 28.5 bits (62), Expect(3) = 3e-11 Identities = 9/11 (81%), Positives = 9/11 (81%) Frame = -2 Query: 178 WVVCFIQAAWH 146 W CFIQAAWH Sbjct: 631 WAACFIQAAWH 641 >XP_010914081.1 PREDICTED: probable cyclic nucleotide-gated ion channel 14 [Elaeis guineensis] Length = 722 Score = 55.1 bits (131), Expect(3) = 3e-11 Identities = 36/75 (48%), Positives = 44/75 (58%) Frame = -3 Query: 402 EELPS*ALLTKSTLYLPFQPEQ*EHYCLPEKRRQDGIIKVEAFALQAEVLKFLDYQFRRR 223 EEL + ALL KST+ LP R +++VEAFAL+AE LKF+ QFRR Sbjct: 553 EELLAWALLPKSTVNLP-----------SSTRTVRALVEVEAFALRAEDLKFVANQFRRL 601 Query: 222 VSKKLQHNL*FCSRH 178 SKKLQH F S+H Sbjct: 602 HSKKLQHTFRFYSQH 616 Score = 31.2 bits (69), Expect(3) = 3e-11 Identities = 17/22 (77%), Positives = 17/22 (77%), Gaps = 1/22 (4%) Frame = -1 Query: 476 RLESSTTKG-RTSFSNSILLRP 414 RLESSTT G RT F NSI LRP Sbjct: 526 RLESSTTNGGRTGFFNSIALRP 547 Score = 28.5 bits (62), Expect(3) = 3e-11 Identities = 9/11 (81%), Positives = 9/11 (81%) Frame = -2 Query: 178 WVVCFIQAAWH 146 W CFIQAAWH Sbjct: 620 WAACFIQAAWH 630