BLASTX nr result
ID: Panax24_contig00039204
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00039204 (369 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017219588.1 PREDICTED: uncharacterized protein LOC108196696 [... 62 7e-09 >XP_017219588.1 PREDICTED: uncharacterized protein LOC108196696 [Daucus carota subsp. sativus] Length = 922 Score = 62.4 bits (150), Expect = 7e-09 Identities = 29/55 (52%), Positives = 36/55 (65%) Frame = +3 Query: 177 STTSRSIQPRFLKIPYSKHCGNVVPESPIANPSNFTLQLSNAIFSGGGEILRHQN 341 S S I P F +IPYSKHC +VV E+P + +N TL L AIF+GG EI H+N Sbjct: 39 SVNSYKISPNFRQIPYSKHCNDVVAETPSLHLTNLTLDLPTAIFAGGAEIFGHRN 93