BLASTX nr result
ID: Panax24_contig00038968
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00038968 (388 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ABU68268.1 putative ethylene receptor, partial [Prunus salicina] 94 3e-23 ABL63477.1 ethylene receptor, partial [Coffea arabica] ABL63478.... 94 6e-23 XP_003605421.2 hybrid sensory histidine kinase [Medicago truncat... 97 8e-21 XP_004515182.1 PREDICTED: ethylene receptor isoform X3 [Cicer ar... 96 1e-20 XP_004515181.1 PREDICTED: ethylene receptor isoform X2 [Cicer ar... 96 1e-20 XP_004515179.1 PREDICTED: ethylene receptor isoform X1 [Cicer ar... 96 1e-20 GAU48340.1 hypothetical protein TSUD_267650 [Trifolium subterran... 96 1e-20 XP_018806529.1 PREDICTED: ethylene receptor [Juglans regia] 96 2e-20 XP_006442237.1 hypothetical protein CICLE_v10019003mg [Citrus cl... 95 4e-20 KDO50510.1 hypothetical protein CISIN_1g004636mg [Citrus sinensis] 95 4e-20 XP_006442238.1 hypothetical protein CICLE_v10019003mg [Citrus cl... 95 4e-20 XP_010279611.1 PREDICTED: ethylene receptor isoform X2 [Nelumbo ... 95 4e-20 AKN91183.1 ETR1 [Mangifera indica] 95 4e-20 AAF61919.1 ethylene receptor [Mangifera indica] 95 4e-20 AKO62847.1 ETR1 [Mangifera indica] 95 4e-20 AIT39449.1 ethylene receptor 1 [Mangifera indica] AIT52522.1 eth... 95 4e-20 KDO50509.1 hypothetical protein CISIN_1g004636mg [Citrus sinensis] 95 4e-20 NP_001275863.1 ethylene response 1 [Citrus sinensis] XP_00647791... 95 4e-20 XP_006442239.1 hypothetical protein CICLE_v10019003mg [Citrus cl... 95 4e-20 AFS33091.2 ethylene receptor [Paeonia lactiflora] 95 4e-20 >ABU68268.1 putative ethylene receptor, partial [Prunus salicina] Length = 46 Score = 94.0 bits (232), Expect = 3e-23 Identities = 42/44 (95%), Positives = 44/44 (100%) Frame = -3 Query: 134 MESCNCVEPQWPADDLLMKYQYISDFFIALAYFSIPLELIYFVK 3 ME+CNCVEPQWPAD+LLMKYQYISDFFIALAYFSIPLELIYFVK Sbjct: 1 MEACNCVEPQWPADELLMKYQYISDFFIALAYFSIPLELIYFVK 44 >ABL63477.1 ethylene receptor, partial [Coffea arabica] ABL63478.1 ethylene receptor, partial [Coffea sp. Moloundou] ABL63479.1 ethylene receptor, partial [Coffea racemosa] ABL63480.1 ethylene receptor, partial [Coffea sessiliflora] ABL63481.1 ethylene receptor, partial [Coffea heterocalyx] ABL63482.1 ethylene receptor, partial [Coffea canephora] Length = 55 Score = 93.6 bits (231), Expect = 6e-23 Identities = 41/44 (93%), Positives = 44/44 (100%) Frame = -3 Query: 134 MESCNCVEPQWPADDLLMKYQYISDFFIALAYFSIPLELIYFVK 3 MESCNC+EPQWPAD+LLM+YQYISDFFIALAYFSIPLELIYFVK Sbjct: 1 MESCNCIEPQWPADELLMRYQYISDFFIALAYFSIPLELIYFVK 44 >XP_003605421.2 hybrid sensory histidine kinase [Medicago truncatula] AES87618.2 hybrid sensory histidine kinase [Medicago truncatula] Length = 790 Score = 96.7 bits (239), Expect = 8e-21 Identities = 43/46 (93%), Positives = 45/46 (97%) Frame = -3 Query: 140 LTMESCNCVEPQWPADDLLMKYQYISDFFIALAYFSIPLELIYFVK 3 + MESCNC+EPQWPADDLLMKYQYISDFFIALAYFSIPLELIYFVK Sbjct: 49 IMMESCNCIEPQWPADDLLMKYQYISDFFIALAYFSIPLELIYFVK 94 >XP_004515182.1 PREDICTED: ethylene receptor isoform X3 [Cicer arietinum] Length = 629 Score = 96.3 bits (238), Expect = 1e-20 Identities = 43/44 (97%), Positives = 44/44 (100%) Frame = -3 Query: 134 MESCNCVEPQWPADDLLMKYQYISDFFIALAYFSIPLELIYFVK 3 MESCNC+EPQWPADDLLMKYQYISDFFIALAYFSIPLELIYFVK Sbjct: 1 MESCNCIEPQWPADDLLMKYQYISDFFIALAYFSIPLELIYFVK 44 >XP_004515181.1 PREDICTED: ethylene receptor isoform X2 [Cicer arietinum] Length = 646 Score = 96.3 bits (238), Expect = 1e-20 Identities = 43/44 (97%), Positives = 44/44 (100%) Frame = -3 Query: 134 MESCNCVEPQWPADDLLMKYQYISDFFIALAYFSIPLELIYFVK 3 MESCNC+EPQWPADDLLMKYQYISDFFIALAYFSIPLELIYFVK Sbjct: 1 MESCNCIEPQWPADDLLMKYQYISDFFIALAYFSIPLELIYFVK 44 >XP_004515179.1 PREDICTED: ethylene receptor isoform X1 [Cicer arietinum] Length = 737 Score = 96.3 bits (238), Expect = 1e-20 Identities = 43/44 (97%), Positives = 44/44 (100%) Frame = -3 Query: 134 MESCNCVEPQWPADDLLMKYQYISDFFIALAYFSIPLELIYFVK 3 MESCNC+EPQWPADDLLMKYQYISDFFIALAYFSIPLELIYFVK Sbjct: 1 MESCNCIEPQWPADDLLMKYQYISDFFIALAYFSIPLELIYFVK 44 >GAU48340.1 hypothetical protein TSUD_267650 [Trifolium subterraneum] Length = 740 Score = 96.3 bits (238), Expect = 1e-20 Identities = 43/44 (97%), Positives = 44/44 (100%) Frame = -3 Query: 134 MESCNCVEPQWPADDLLMKYQYISDFFIALAYFSIPLELIYFVK 3 MESCNC+EPQWPADDLLMKYQYISDFFIALAYFSIPLELIYFVK Sbjct: 1 MESCNCIEPQWPADDLLMKYQYISDFFIALAYFSIPLELIYFVK 44 >XP_018806529.1 PREDICTED: ethylene receptor [Juglans regia] Length = 742 Score = 95.5 bits (236), Expect = 2e-20 Identities = 42/45 (93%), Positives = 45/45 (100%) Frame = -3 Query: 137 TMESCNCVEPQWPADDLLMKYQYISDFFIALAYFSIPLELIYFVK 3 TMESCNC++PQWPAD+LLMKYQYISDFFIALAYFSIPLELIYFVK Sbjct: 4 TMESCNCIDPQWPADELLMKYQYISDFFIALAYFSIPLELIYFVK 48 >XP_006442237.1 hypothetical protein CICLE_v10019003mg [Citrus clementina] ESR55477.1 hypothetical protein CICLE_v10019003mg [Citrus clementina] Length = 580 Score = 94.7 bits (234), Expect = 4e-20 Identities = 42/44 (95%), Positives = 44/44 (100%) Frame = -3 Query: 134 MESCNCVEPQWPADDLLMKYQYISDFFIALAYFSIPLELIYFVK 3 MESCNC+EPQWPAD+LLMKYQYISDFFIALAYFSIPLELIYFVK Sbjct: 1 MESCNCIEPQWPADELLMKYQYISDFFIALAYFSIPLELIYFVK 44 >KDO50510.1 hypothetical protein CISIN_1g004636mg [Citrus sinensis] Length = 604 Score = 94.7 bits (234), Expect = 4e-20 Identities = 42/44 (95%), Positives = 44/44 (100%) Frame = -3 Query: 134 MESCNCVEPQWPADDLLMKYQYISDFFIALAYFSIPLELIYFVK 3 MESCNC+EPQWPAD+LLMKYQYISDFFIALAYFSIPLELIYFVK Sbjct: 1 MESCNCIEPQWPADELLMKYQYISDFFIALAYFSIPLELIYFVK 44 >XP_006442238.1 hypothetical protein CICLE_v10019003mg [Citrus clementina] ESR55478.1 hypothetical protein CICLE_v10019003mg [Citrus clementina] Length = 604 Score = 94.7 bits (234), Expect = 4e-20 Identities = 42/44 (95%), Positives = 44/44 (100%) Frame = -3 Query: 134 MESCNCVEPQWPADDLLMKYQYISDFFIALAYFSIPLELIYFVK 3 MESCNC+EPQWPAD+LLMKYQYISDFFIALAYFSIPLELIYFVK Sbjct: 1 MESCNCIEPQWPADELLMKYQYISDFFIALAYFSIPLELIYFVK 44 >XP_010279611.1 PREDICTED: ethylene receptor isoform X2 [Nelumbo nucifera] Length = 626 Score = 94.7 bits (234), Expect = 4e-20 Identities = 42/44 (95%), Positives = 44/44 (100%) Frame = -3 Query: 134 MESCNCVEPQWPADDLLMKYQYISDFFIALAYFSIPLELIYFVK 3 MESCNC+EPQWPAD+LLMKYQYISDFFIALAYFSIPLELIYFVK Sbjct: 1 MESCNCIEPQWPADELLMKYQYISDFFIALAYFSIPLELIYFVK 44 >AKN91183.1 ETR1 [Mangifera indica] Length = 739 Score = 94.7 bits (234), Expect = 4e-20 Identities = 42/44 (95%), Positives = 44/44 (100%) Frame = -3 Query: 134 MESCNCVEPQWPADDLLMKYQYISDFFIALAYFSIPLELIYFVK 3 MESCNC+EPQWPAD+LLMKYQYISDFFIALAYFSIPLELIYFVK Sbjct: 1 MESCNCIEPQWPADELLMKYQYISDFFIALAYFSIPLELIYFVK 44 >AAF61919.1 ethylene receptor [Mangifera indica] Length = 739 Score = 94.7 bits (234), Expect = 4e-20 Identities = 42/44 (95%), Positives = 44/44 (100%) Frame = -3 Query: 134 MESCNCVEPQWPADDLLMKYQYISDFFIALAYFSIPLELIYFVK 3 MESCNC+EPQWPAD+LLMKYQYISDFFIALAYFSIPLELIYFVK Sbjct: 1 MESCNCIEPQWPADELLMKYQYISDFFIALAYFSIPLELIYFVK 44 >AKO62847.1 ETR1 [Mangifera indica] Length = 739 Score = 94.7 bits (234), Expect = 4e-20 Identities = 42/44 (95%), Positives = 44/44 (100%) Frame = -3 Query: 134 MESCNCVEPQWPADDLLMKYQYISDFFIALAYFSIPLELIYFVK 3 MESCNC+EPQWPAD+LLMKYQYISDFFIALAYFSIPLELIYFVK Sbjct: 1 MESCNCIEPQWPADELLMKYQYISDFFIALAYFSIPLELIYFVK 44 >AIT39449.1 ethylene receptor 1 [Mangifera indica] AIT52522.1 ethylene receptor 1 [Mangifera indica] Length = 739 Score = 94.7 bits (234), Expect = 4e-20 Identities = 42/44 (95%), Positives = 44/44 (100%) Frame = -3 Query: 134 MESCNCVEPQWPADDLLMKYQYISDFFIALAYFSIPLELIYFVK 3 MESCNC+EPQWPAD+LLMKYQYISDFFIALAYFSIPLELIYFVK Sbjct: 1 MESCNCIEPQWPADELLMKYQYISDFFIALAYFSIPLELIYFVK 44 >KDO50509.1 hypothetical protein CISIN_1g004636mg [Citrus sinensis] Length = 740 Score = 94.7 bits (234), Expect = 4e-20 Identities = 42/44 (95%), Positives = 44/44 (100%) Frame = -3 Query: 134 MESCNCVEPQWPADDLLMKYQYISDFFIALAYFSIPLELIYFVK 3 MESCNC+EPQWPAD+LLMKYQYISDFFIALAYFSIPLELIYFVK Sbjct: 1 MESCNCIEPQWPADELLMKYQYISDFFIALAYFSIPLELIYFVK 44 >NP_001275863.1 ethylene response 1 [Citrus sinensis] XP_006477915.1 PREDICTED: ethylene response 1 isoform X1 [Citrus sinensis] ADB25213.1 ethylene response 1 [Citrus sinensis] ADB25217.1 ethylene response 1 [Citrus hybrid cultivar] Length = 740 Score = 94.7 bits (234), Expect = 4e-20 Identities = 42/44 (95%), Positives = 44/44 (100%) Frame = -3 Query: 134 MESCNCVEPQWPADDLLMKYQYISDFFIALAYFSIPLELIYFVK 3 MESCNC+EPQWPAD+LLMKYQYISDFFIALAYFSIPLELIYFVK Sbjct: 1 MESCNCIEPQWPADELLMKYQYISDFFIALAYFSIPLELIYFVK 44 >XP_006442239.1 hypothetical protein CICLE_v10019003mg [Citrus clementina] XP_006442240.1 hypothetical protein CICLE_v10019003mg [Citrus clementina] ESR55479.1 hypothetical protein CICLE_v10019003mg [Citrus clementina] ESR55480.1 hypothetical protein CICLE_v10019003mg [Citrus clementina] Length = 740 Score = 94.7 bits (234), Expect = 4e-20 Identities = 42/44 (95%), Positives = 44/44 (100%) Frame = -3 Query: 134 MESCNCVEPQWPADDLLMKYQYISDFFIALAYFSIPLELIYFVK 3 MESCNC+EPQWPAD+LLMKYQYISDFFIALAYFSIPLELIYFVK Sbjct: 1 MESCNCIEPQWPADELLMKYQYISDFFIALAYFSIPLELIYFVK 44 >AFS33091.2 ethylene receptor [Paeonia lactiflora] Length = 740 Score = 94.7 bits (234), Expect = 4e-20 Identities = 42/44 (95%), Positives = 44/44 (100%) Frame = -3 Query: 134 MESCNCVEPQWPADDLLMKYQYISDFFIALAYFSIPLELIYFVK 3 MESCNC+EPQWPAD+LLMKYQYISDFFIALAYFSIPLELIYFVK Sbjct: 1 MESCNCIEPQWPADELLMKYQYISDFFIALAYFSIPLELIYFVK 44