BLASTX nr result
ID: Panax24_contig00038751
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00038751 (842 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017215137.1 PREDICTED: pentatricopeptide repeat-containing pr... 74 3e-11 XP_009791185.1 PREDICTED: pentatricopeptide repeat-containing pr... 69 1e-09 XP_016500105.1 PREDICTED: pentatricopeptide repeat-containing pr... 69 1e-09 XP_018626240.1 PREDICTED: pentatricopeptide repeat-containing pr... 69 2e-09 XP_016572850.1 PREDICTED: pentatricopeptide repeat-containing pr... 69 2e-09 XP_018626231.1 PREDICTED: pentatricopeptide repeat-containing pr... 69 2e-09 XP_016502873.1 PREDICTED: pentatricopeptide repeat-containing pr... 69 2e-09 XP_015580285.1 PREDICTED: pentatricopeptide repeat-containing pr... 68 3e-09 EEF51569.1 pentatricopeptide repeat-containing protein, putative... 68 3e-09 XP_019227745.1 PREDICTED: pentatricopeptide repeat-containing pr... 68 4e-09 XP_015085766.1 PREDICTED: pentatricopeptide repeat-containing pr... 68 4e-09 XP_006352876.1 PREDICTED: pentatricopeptide repeat-containing pr... 68 4e-09 XP_010325562.1 PREDICTED: pentatricopeptide repeat-containing pr... 68 4e-09 XP_019176973.1 PREDICTED: pentatricopeptide repeat-containing pr... 67 1e-08 KDP22434.1 hypothetical protein JCGZ_26265 [Jatropha curcas] 65 2e-08 XP_012090764.1 PREDICTED: pentatricopeptide repeat-containing pr... 65 2e-08 XP_018823887.1 PREDICTED: pentatricopeptide repeat-containing pr... 65 3e-08 XP_003635514.3 PREDICTED: pentatricopeptide repeat-containing pr... 64 6e-08 CBI38482.3 unnamed protein product, partial [Vitis vinifera] 64 7e-08 CAN67256.1 hypothetical protein VITISV_039434 [Vitis vinifera] 64 1e-07 >XP_017215137.1 PREDICTED: pentatricopeptide repeat-containing protein At5g64320, mitochondrial [Daucus carota subsp. sativus] XP_017215146.1 PREDICTED: pentatricopeptide repeat-containing protein At5g64320, mitochondrial [Daucus carota subsp. sativus] XP_017215154.1 PREDICTED: pentatricopeptide repeat-containing protein At5g64320, mitochondrial [Daucus carota subsp. sativus] XP_017215162.1 PREDICTED: pentatricopeptide repeat-containing protein At5g64320, mitochondrial [Daucus carota subsp. sativus] XP_017215170.1 PREDICTED: pentatricopeptide repeat-containing protein At5g64320, mitochondrial [Daucus carota subsp. sativus] Length = 732 Score = 74.3 bits (181), Expect = 3e-11 Identities = 32/48 (66%), Positives = 41/48 (85%) Frame = -3 Query: 840 LICSYCKAGIRDDAYELLSRGVTNGFIPNDVTWYLLVKNFVVEQYEEI 697 LICS+CKA + D+AY LL RGV+NGFIPNDVTWY L++ V+++YEEI Sbjct: 670 LICSFCKADMLDNAYALLCRGVSNGFIPNDVTWYFLIRYSVMKKYEEI 717 >XP_009791185.1 PREDICTED: pentatricopeptide repeat-containing protein At5g64320, mitochondrial [Nicotiana sylvestris] Length = 668 Score = 69.3 bits (168), Expect = 1e-09 Identities = 30/48 (62%), Positives = 38/48 (79%) Frame = -3 Query: 840 LICSYCKAGIRDDAYELLSRGVTNGFIPNDVTWYLLVKNFVVEQYEEI 697 LI SYCK + DDAY LL+RG+ GFIPN+VTWY+LV+NFV + YE + Sbjct: 619 LISSYCKMHMLDDAYTLLTRGIAVGFIPNNVTWYILVRNFVRKSYESV 666 >XP_016500105.1 PREDICTED: pentatricopeptide repeat-containing protein At5g64320, mitochondrial-like [Nicotiana tabacum] Length = 717 Score = 69.3 bits (168), Expect = 1e-09 Identities = 30/48 (62%), Positives = 38/48 (79%) Frame = -3 Query: 840 LICSYCKAGIRDDAYELLSRGVTNGFIPNDVTWYLLVKNFVVEQYEEI 697 LI SYCK + DDAY LL+RG+ GFIPN+VTWY+LV+NFV + YE + Sbjct: 668 LISSYCKMHMLDDAYTLLTRGIAVGFIPNNVTWYILVRNFVRKSYESV 715 >XP_018626240.1 PREDICTED: pentatricopeptide repeat-containing protein At5g64320, mitochondrial-like isoform X2 [Nicotiana tomentosiformis] Length = 678 Score = 68.9 bits (167), Expect = 2e-09 Identities = 30/48 (62%), Positives = 38/48 (79%) Frame = -3 Query: 840 LICSYCKAGIRDDAYELLSRGVTNGFIPNDVTWYLLVKNFVVEQYEEI 697 LI SYCK + DDAY LL+RG+ GFIPN+VTWY+LV+NFV + YE + Sbjct: 629 LISSYCKMHMLDDAYTLLTRGIAVGFIPNNVTWYILVRNFVRKSYESL 676 >XP_016572850.1 PREDICTED: pentatricopeptide repeat-containing protein At5g64320, mitochondrial-like [Capsicum annuum] XP_016572858.1 PREDICTED: pentatricopeptide repeat-containing protein At5g64320, mitochondrial-like [Capsicum annuum] XP_016541626.1 PREDICTED: pentatricopeptide repeat-containing protein At5g64320, mitochondrial-like [Capsicum annuum] Length = 720 Score = 68.9 bits (167), Expect = 2e-09 Identities = 31/50 (62%), Positives = 39/50 (78%) Frame = -3 Query: 840 LICSYCKAGIRDDAYELLSRGVTNGFIPNDVTWYLLVKNFVVEQYEEI*T 691 LI SYCK + DDAY LL+RG+ GFIPN+VTWY+LV+NFV + YE + T Sbjct: 669 LILSYCKMRMIDDAYTLLARGIAVGFIPNNVTWYILVRNFVRKSYEPVTT 718 >XP_018626231.1 PREDICTED: pentatricopeptide repeat-containing protein At5g64320, mitochondrial-like isoform X1 [Nicotiana tomentosiformis] XP_018626232.1 PREDICTED: pentatricopeptide repeat-containing protein At5g64320, mitochondrial-like isoform X1 [Nicotiana tomentosiformis] XP_018626233.1 PREDICTED: pentatricopeptide repeat-containing protein At5g64320, mitochondrial-like isoform X1 [Nicotiana tomentosiformis] XP_018626234.1 PREDICTED: pentatricopeptide repeat-containing protein At5g64320, mitochondrial-like isoform X1 [Nicotiana tomentosiformis] XP_018626235.1 PREDICTED: pentatricopeptide repeat-containing protein At5g64320, mitochondrial-like isoform X1 [Nicotiana tomentosiformis] XP_018626236.1 PREDICTED: pentatricopeptide repeat-containing protein At5g64320, mitochondrial-like isoform X1 [Nicotiana tomentosiformis] XP_009600516.2 PREDICTED: pentatricopeptide repeat-containing protein At5g64320, mitochondrial-like isoform X1 [Nicotiana tomentosiformis] XP_018626237.1 PREDICTED: pentatricopeptide repeat-containing protein At5g64320, mitochondrial-like isoform X1 [Nicotiana tomentosiformis] XP_018626238.1 PREDICTED: pentatricopeptide repeat-containing protein At5g64320, mitochondrial-like isoform X1 [Nicotiana tomentosiformis] XP_018626239.1 PREDICTED: pentatricopeptide repeat-containing protein At5g64320, mitochondrial-like isoform X1 [Nicotiana tomentosiformis] Length = 727 Score = 68.9 bits (167), Expect = 2e-09 Identities = 30/48 (62%), Positives = 38/48 (79%) Frame = -3 Query: 840 LICSYCKAGIRDDAYELLSRGVTNGFIPNDVTWYLLVKNFVVEQYEEI 697 LI SYCK + DDAY LL+RG+ GFIPN+VTWY+LV+NFV + YE + Sbjct: 678 LISSYCKMHMLDDAYTLLTRGIAVGFIPNNVTWYILVRNFVRKSYESL 725 >XP_016502873.1 PREDICTED: pentatricopeptide repeat-containing protein At5g64320, mitochondrial-like [Nicotiana tabacum] XP_016502874.1 PREDICTED: pentatricopeptide repeat-containing protein At5g64320, mitochondrial-like [Nicotiana tabacum] XP_016502875.1 PREDICTED: pentatricopeptide repeat-containing protein At5g64320, mitochondrial-like [Nicotiana tabacum] XP_016502876.1 PREDICTED: pentatricopeptide repeat-containing protein At5g64320, mitochondrial-like [Nicotiana tabacum] XP_016502877.1 PREDICTED: pentatricopeptide repeat-containing protein At5g64320, mitochondrial-like [Nicotiana tabacum] XP_016502878.1 PREDICTED: pentatricopeptide repeat-containing protein At5g64320, mitochondrial-like [Nicotiana tabacum] XP_016502879.1 PREDICTED: pentatricopeptide repeat-containing protein At5g64320, mitochondrial-like [Nicotiana tabacum] Length = 727 Score = 68.9 bits (167), Expect = 2e-09 Identities = 30/48 (62%), Positives = 38/48 (79%) Frame = -3 Query: 840 LICSYCKAGIRDDAYELLSRGVTNGFIPNDVTWYLLVKNFVVEQYEEI 697 LI SYCK + DDAY LL+RG+ GFIPN+VTWY+LV+NFV + YE + Sbjct: 678 LISSYCKMHMLDDAYTLLTRGIAVGFIPNNVTWYILVRNFVRKSYESL 725 >XP_015580285.1 PREDICTED: pentatricopeptide repeat-containing protein At5g64320, mitochondrial isoform X1 [Ricinus communis] Length = 721 Score = 68.2 bits (165), Expect = 3e-09 Identities = 30/43 (69%), Positives = 35/43 (81%) Frame = -3 Query: 840 LICSYCKAGIRDDAYELLSRGVTNGFIPNDVTWYLLVKNFVVE 712 LIC +C+AG+ DDAY LL RGV N FIPNDVTWY+LV NF+ E Sbjct: 666 LICWHCRAGMFDDAYLLLLRGVENAFIPNDVTWYILVSNFIKE 708 >EEF51569.1 pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 774 Score = 68.2 bits (165), Expect = 3e-09 Identities = 30/43 (69%), Positives = 35/43 (81%) Frame = -3 Query: 840 LICSYCKAGIRDDAYELLSRGVTNGFIPNDVTWYLLVKNFVVE 712 LIC +C+AG+ DDAY LL RGV N FIPNDVTWY+LV NF+ E Sbjct: 666 LICWHCRAGMFDDAYLLLLRGVENAFIPNDVTWYILVSNFIKE 708 >XP_019227745.1 PREDICTED: pentatricopeptide repeat-containing protein At5g64320, mitochondrial [Nicotiana attenuata] XP_019227746.1 PREDICTED: pentatricopeptide repeat-containing protein At5g64320, mitochondrial [Nicotiana attenuata] OIT31187.1 pentatricopeptide repeat-containing protein, mitochondrial [Nicotiana attenuata] Length = 717 Score = 67.8 bits (164), Expect = 4e-09 Identities = 29/48 (60%), Positives = 38/48 (79%) Frame = -3 Query: 840 LICSYCKAGIRDDAYELLSRGVTNGFIPNDVTWYLLVKNFVVEQYEEI 697 LI S+CK + DDAY LL+RG+ GFIPN+VTWY+LV+NFV + YE + Sbjct: 668 LISSFCKMHMLDDAYTLLTRGIAVGFIPNNVTWYILVRNFVRKSYESV 715 >XP_015085766.1 PREDICTED: pentatricopeptide repeat-containing protein At5g64320, mitochondrial [Solanum pennellii] Length = 720 Score = 67.8 bits (164), Expect = 4e-09 Identities = 30/50 (60%), Positives = 37/50 (74%) Frame = -3 Query: 840 LICSYCKAGIRDDAYELLSRGVTNGFIPNDVTWYLLVKNFVVEQYEEI*T 691 LI SYCK + DDAY L +RG+ GFIPN VTWY+LV+NFV + YE + T Sbjct: 669 LISSYCKMRMLDDAYTLFTRGIAVGFIPNSVTWYILVRNFVRKSYESVTT 718 >XP_006352876.1 PREDICTED: pentatricopeptide repeat-containing protein At5g64320, mitochondrial isoform X1 [Solanum tuberosum] XP_006352877.1 PREDICTED: pentatricopeptide repeat-containing protein At5g64320, mitochondrial isoform X1 [Solanum tuberosum] XP_015166595.1 PREDICTED: pentatricopeptide repeat-containing protein At5g64320, mitochondrial isoform X1 [Solanum tuberosum] XP_015166596.1 PREDICTED: pentatricopeptide repeat-containing protein At5g64320, mitochondrial isoform X1 [Solanum tuberosum] Length = 720 Score = 67.8 bits (164), Expect = 4e-09 Identities = 30/50 (60%), Positives = 37/50 (74%) Frame = -3 Query: 840 LICSYCKAGIRDDAYELLSRGVTNGFIPNDVTWYLLVKNFVVEQYEEI*T 691 LI SYCK + DDAY L +RG+ GFIPN VTWY+LV+NFV + YE + T Sbjct: 669 LISSYCKMRMLDDAYTLFTRGIAVGFIPNSVTWYILVRNFVRKSYESVTT 718 >XP_010325562.1 PREDICTED: pentatricopeptide repeat-containing protein At5g64320, mitochondrial [Solanum lycopersicum] XP_019070867.1 PREDICTED: pentatricopeptide repeat-containing protein At5g64320, mitochondrial [Solanum lycopersicum] XP_019070868.1 PREDICTED: pentatricopeptide repeat-containing protein At5g64320, mitochondrial [Solanum lycopersicum] XP_019070869.1 PREDICTED: pentatricopeptide repeat-containing protein At5g64320, mitochondrial [Solanum lycopersicum] XP_019070870.1 PREDICTED: pentatricopeptide repeat-containing protein At5g64320, mitochondrial [Solanum lycopersicum] Length = 720 Score = 67.8 bits (164), Expect = 4e-09 Identities = 30/50 (60%), Positives = 37/50 (74%) Frame = -3 Query: 840 LICSYCKAGIRDDAYELLSRGVTNGFIPNDVTWYLLVKNFVVEQYEEI*T 691 LI SYCK + DDAY L +RG+ GFIPN VTWY+LV+NFV + YE + T Sbjct: 669 LISSYCKMRMLDDAYTLFTRGIAVGFIPNSVTWYILVRNFVRKSYESVTT 718 >XP_019176973.1 PREDICTED: pentatricopeptide repeat-containing protein At5g64320, mitochondrial [Ipomoea nil] Length = 720 Score = 66.6 bits (161), Expect = 1e-08 Identities = 29/43 (67%), Positives = 36/43 (83%) Frame = -3 Query: 840 LICSYCKAGIRDDAYELLSRGVTNGFIPNDVTWYLLVKNFVVE 712 LI ++CK G+ DDAY LL RGV+NGFIPN +TW++LV NFVVE Sbjct: 669 LISTFCKMGMLDDAYMLLVRGVSNGFIPNGITWHVLVNNFVVE 711 >KDP22434.1 hypothetical protein JCGZ_26265 [Jatropha curcas] Length = 724 Score = 65.5 bits (158), Expect = 2e-08 Identities = 30/51 (58%), Positives = 38/51 (74%) Frame = -3 Query: 840 LICSYCKAGIRDDAYELLSRGVTNGFIPNDVTWYLLVKNFVVEQYEEI*TF 688 LIC YC+ G+ DDA+ LL RGV N F+P+DVTWY+LV NFV + +E TF Sbjct: 669 LICWYCREGMFDDAFLLLHRGVNNDFVPSDVTWYILVSNFVKKIGQENSTF 719 >XP_012090764.1 PREDICTED: pentatricopeptide repeat-containing protein At5g64320, mitochondrial [Jatropha curcas] Length = 802 Score = 65.5 bits (158), Expect = 2e-08 Identities = 30/51 (58%), Positives = 38/51 (74%) Frame = -3 Query: 840 LICSYCKAGIRDDAYELLSRGVTNGFIPNDVTWYLLVKNFVVEQYEEI*TF 688 LIC YC+ G+ DDA+ LL RGV N F+P+DVTWY+LV NFV + +E TF Sbjct: 747 LICWYCREGMFDDAFLLLHRGVNNDFVPSDVTWYILVSNFVKKIGQENSTF 797 >XP_018823887.1 PREDICTED: pentatricopeptide repeat-containing protein At5g64320, mitochondrial-like isoform X1 [Juglans regia] Length = 843 Score = 65.1 bits (157), Expect = 3e-08 Identities = 32/51 (62%), Positives = 35/51 (68%) Frame = -3 Query: 840 LICSYCKAGIRDDAYELLSRGVTNGFIPNDVTWYLLVKNFVVEQYEEI*TF 688 LI YC+ G+ DDAY L GV NGF+PNDVTWYLLV NFV E E TF Sbjct: 788 LIRWYCREGMFDDAYLFLREGVDNGFVPNDVTWYLLVTNFVRESAMESQTF 838 >XP_003635514.3 PREDICTED: pentatricopeptide repeat-containing protein At5g64320, mitochondrial-like [Vitis vinifera] Length = 347 Score = 63.5 bits (153), Expect = 6e-08 Identities = 29/47 (61%), Positives = 37/47 (78%) Frame = -3 Query: 840 LICSYCKAGIRDDAYELLSRGVTNGFIPNDVTWYLLVKNFVVEQYEE 700 LI +CK G+ DDA+ LLSRGV +GFIPN+VTWY+LV NF+ E +E Sbjct: 300 LISWHCKEGMFDDAHLLLSRGVDSGFIPNEVTWYILVSNFIKEGDQE 346 >CBI38482.3 unnamed protein product, partial [Vitis vinifera] Length = 368 Score = 63.5 bits (153), Expect = 7e-08 Identities = 29/47 (61%), Positives = 37/47 (78%) Frame = -3 Query: 840 LICSYCKAGIRDDAYELLSRGVTNGFIPNDVTWYLLVKNFVVEQYEE 700 LI +CK G+ DDA+ LLSRGV +GFIPN+VTWY+LV NF+ E +E Sbjct: 321 LISWHCKEGMFDDAHLLLSRGVDSGFIPNEVTWYILVSNFIKEGDQE 367 >CAN67256.1 hypothetical protein VITISV_039434 [Vitis vinifera] Length = 722 Score = 63.5 bits (153), Expect = 1e-07 Identities = 29/47 (61%), Positives = 37/47 (78%) Frame = -3 Query: 840 LICSYCKAGIRDDAYELLSRGVTNGFIPNDVTWYLLVKNFVVEQYEE 700 LI +CK G+ DDA+ LLSRGV +GFIPN+VTWY+LV NF+ E +E Sbjct: 675 LISWHCKEGMFDDAHLLLSRGVDSGFIPNEVTWYILVSNFIKEGDQE 721