BLASTX nr result
ID: Panax24_contig00038104
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00038104 (387 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value OMP03610.1 hypothetical protein COLO4_10306 [Corchorus olitorius] 65 7e-10 OMO72680.1 hypothetical protein CCACVL1_17666 [Corchorus capsula... 64 2e-09 XP_007027170.2 PREDICTED: pentatricopeptide repeat-containing pr... 62 8e-09 EOY07672.1 Pentatricopeptide repeat (PPR) superfamily protein, p... 62 8e-09 XP_012486144.1 PREDICTED: pentatricopeptide repeat-containing pr... 60 5e-08 XP_016671134.1 PREDICTED: pentatricopeptide repeat-containing pr... 60 5e-08 XP_017608585.1 PREDICTED: pentatricopeptide repeat-containing pr... 58 3e-07 XP_016669754.1 PREDICTED: pentatricopeptide repeat-containing pr... 58 3e-07 XP_008241927.1 PREDICTED: pentatricopeptide repeat-containing pr... 58 3e-07 XP_004497438.1 PREDICTED: pentatricopeptide repeat-containing pr... 57 5e-07 XP_004497436.1 PREDICTED: pentatricopeptide repeat-containing pr... 57 5e-07 XP_009341910.1 PREDICTED: pentatricopeptide repeat-containing pr... 57 6e-07 XP_008387694.1 PREDICTED: pentatricopeptide repeat-containing pr... 57 6e-07 XP_002273893.1 PREDICTED: pentatricopeptide repeat-containing pr... 57 9e-07 GAU38027.1 hypothetical protein TSUD_395870 [Trifolium subterran... 55 2e-06 XP_015949274.1 PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide... 55 3e-06 XP_004305232.1 PREDICTED: pentatricopeptide repeat-containing pr... 55 4e-06 XP_016183310.1 PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide... 54 5e-06 XP_007208103.1 hypothetical protein PRUPE_ppa001024mg [Prunus pe... 54 8e-06 >OMP03610.1 hypothetical protein COLO4_10306 [Corchorus olitorius] Length = 559 Score = 65.5 bits (158), Expect = 7e-10 Identities = 34/50 (68%), Positives = 39/50 (78%), Gaps = 1/50 (2%) Frame = +1 Query: 1 IEAHGRLQRFIAKDASNERTEEIHALLEG-IARMRDEGYDLMDEFDEESV 147 IE G LQ FIAKD S+ERTEEI+ LLEG + M++EGY L DEFDEESV Sbjct: 508 IETSGGLQSFIAKDKSSERTEEIYVLLEGLLGLMKEEGYTLQDEFDEESV 557 >OMO72680.1 hypothetical protein CCACVL1_17666 [Corchorus capsularis] Length = 656 Score = 64.3 bits (155), Expect = 2e-09 Identities = 34/50 (68%), Positives = 39/50 (78%), Gaps = 1/50 (2%) Frame = +1 Query: 1 IEAHGRLQRFIAKDASNERTEEIHALLEG-IARMRDEGYDLMDEFDEESV 147 IE G LQ FIAKD S+ERTEEI+ LLEG + M++EGY L DEFDEESV Sbjct: 605 IETSGGLQSFIAKDKSSERTEEIYDLLEGLLGLMKEEGYALQDEFDEESV 654 >XP_007027170.2 PREDICTED: pentatricopeptide repeat-containing protein At2g37310 [Theobroma cacao] Length = 667 Score = 62.4 bits (150), Expect = 8e-09 Identities = 32/50 (64%), Positives = 39/50 (78%), Gaps = 1/50 (2%) Frame = +1 Query: 1 IEAHGRLQRFIAKDASNERTEEIHALLEG-IARMRDEGYDLMDEFDEESV 147 IE G LQ FIAKD S+ERTEEI+ LLEG + M++EGY L DE+DEE+V Sbjct: 616 IETSGGLQSFIAKDRSSERTEEIYVLLEGLLGLMKEEGYTLHDEYDEENV 665 >EOY07672.1 Pentatricopeptide repeat (PPR) superfamily protein, putative [Theobroma cacao] Length = 667 Score = 62.4 bits (150), Expect = 8e-09 Identities = 32/50 (64%), Positives = 39/50 (78%), Gaps = 1/50 (2%) Frame = +1 Query: 1 IEAHGRLQRFIAKDASNERTEEIHALLEG-IARMRDEGYDLMDEFDEESV 147 IE G LQ FIAKD S+ERTEEI+ LLEG + M++EGY L DE+DEE+V Sbjct: 616 IETSGGLQSFIAKDRSSERTEEIYVLLEGLLGLMKEEGYTLHDEYDEENV 665 >XP_012486144.1 PREDICTED: pentatricopeptide repeat-containing protein At2g37310 [Gossypium raimondii] KJB36809.1 hypothetical protein B456_006G177200 [Gossypium raimondii] Length = 664 Score = 60.1 bits (144), Expect = 5e-08 Identities = 32/50 (64%), Positives = 39/50 (78%), Gaps = 1/50 (2%) Frame = +1 Query: 1 IEAHGRLQRFIAKDASNERTEEIHALLEG-IARMRDEGYDLMDEFDEESV 147 IE LQ FIAKD S+ERTEEI++LLEG + M++EGY L D+FDEESV Sbjct: 612 IETSVGLQSFIAKDRSSERTEEIYSLLEGLLGLMKEEGYTLHDKFDEESV 661 >XP_016671134.1 PREDICTED: pentatricopeptide repeat-containing protein At2g37310-like [Gossypium hirsutum] Length = 680 Score = 60.1 bits (144), Expect = 5e-08 Identities = 32/50 (64%), Positives = 39/50 (78%), Gaps = 1/50 (2%) Frame = +1 Query: 1 IEAHGRLQRFIAKDASNERTEEIHALLEG-IARMRDEGYDLMDEFDEESV 147 IE LQ FIAKD S+ERTEEI++LLEG + M++EGY L D+FDEESV Sbjct: 628 IETSVGLQSFIAKDRSSERTEEIYSLLEGLLGLMKEEGYTLHDKFDEESV 677 >XP_017608585.1 PREDICTED: pentatricopeptide repeat-containing protein At2g37310 [Gossypium arboreum] Length = 664 Score = 58.2 bits (139), Expect = 3e-07 Identities = 31/50 (62%), Positives = 38/50 (76%), Gaps = 1/50 (2%) Frame = +1 Query: 1 IEAHGRLQRFIAKDASNERTEEIHALLEG-IARMRDEGYDLMDEFDEESV 147 IE LQ FIAKD S+ER EEI++LLEG + M++EGY L D+FDEESV Sbjct: 612 IETSVGLQNFIAKDRSSERIEEIYSLLEGLLGLMKEEGYTLHDKFDEESV 661 >XP_016669754.1 PREDICTED: pentatricopeptide repeat-containing protein At2g37310-like [Gossypium hirsutum] Length = 664 Score = 57.8 bits (138), Expect = 3e-07 Identities = 31/50 (62%), Positives = 38/50 (76%), Gaps = 1/50 (2%) Frame = +1 Query: 1 IEAHGRLQRFIAKDASNERTEEIHALLEG-IARMRDEGYDLMDEFDEESV 147 IE LQ FIAKD S+ER EEI++LLEG + M++EGY L D+FDEESV Sbjct: 612 IETSVGLQSFIAKDRSSERIEEIYSLLEGLLGLMKEEGYTLHDKFDEESV 661 >XP_008241927.1 PREDICTED: pentatricopeptide repeat-containing protein At2g37310 [Prunus mume] Length = 667 Score = 57.8 bits (138), Expect = 3e-07 Identities = 30/52 (57%), Positives = 38/52 (73%), Gaps = 1/52 (1%) Frame = +1 Query: 1 IEAHGRLQRFIAKDASNERTEEIHALLEG-IARMRDEGYDLMDEFDEESVGS 153 IE LQ FIAKD SN RTEEI+ +LEG + M+++GY L+DE DEESV + Sbjct: 616 IETSDGLQSFIAKDTSNGRTEEIYEILEGLLGLMKEKGYVLLDELDEESVNN 667 >XP_004497438.1 PREDICTED: pentatricopeptide repeat-containing protein At2g37310-like [Cicer arietinum] Length = 668 Score = 57.4 bits (137), Expect = 5e-07 Identities = 30/48 (62%), Positives = 36/48 (75%), Gaps = 1/48 (2%) Frame = +1 Query: 1 IEAHGRLQRFIAKDASNERTEEIHALLEG-IARMRDEGYDLMDEFDEE 141 IE GRLQ FIAKD SNE ++EI+ALLEG + MR+EGY L +E D E Sbjct: 620 IETSGRLQSFIAKDMSNEMSDEIYALLEGLLGLMREEGYVLQEELDYE 667 >XP_004497436.1 PREDICTED: pentatricopeptide repeat-containing protein At2g37310-like [Cicer arietinum] Length = 677 Score = 57.4 bits (137), Expect = 5e-07 Identities = 30/48 (62%), Positives = 36/48 (75%), Gaps = 1/48 (2%) Frame = +1 Query: 1 IEAHGRLQRFIAKDASNERTEEIHALLEG-IARMRDEGYDLMDEFDEE 141 IE GRLQ FIAKD SNE ++EI+ALLEG + MR+EGY L +E D E Sbjct: 629 IETSGRLQSFIAKDMSNEMSDEIYALLEGLLGLMREEGYVLQEELDYE 676 >XP_009341910.1 PREDICTED: pentatricopeptide repeat-containing protein At2g37310 [Pyrus x bretschneideri] Length = 667 Score = 57.0 bits (136), Expect = 6e-07 Identities = 30/50 (60%), Positives = 35/50 (70%), Gaps = 1/50 (2%) Frame = +1 Query: 1 IEAHGRLQRFIAKDASNERTEEIHALLEG-IARMRDEGYDLMDEFDEESV 147 IE LQ FI KD SNERTEEI+ LEG + M+++GY L DE DEESV Sbjct: 616 IETSKGLQSFIVKDTSNERTEEIYETLEGLLGMMKEKGYALQDELDEESV 665 >XP_008387694.1 PREDICTED: pentatricopeptide repeat-containing protein At2g37310 [Malus domestica] Length = 678 Score = 57.0 bits (136), Expect = 6e-07 Identities = 29/52 (55%), Positives = 36/52 (69%), Gaps = 1/52 (1%) Frame = +1 Query: 1 IEAHGRLQRFIAKDASNERTEEIHALLEG-IARMRDEGYDLMDEFDEESVGS 153 IE LQ FI KD SNERTEEI+ LEG + M+++GY L DE DEES+ + Sbjct: 616 IETSKGLQSFIVKDTSNERTEEIYETLEGLLGMMKEKGYALQDELDEESISA 667 >XP_002273893.1 PREDICTED: pentatricopeptide repeat-containing protein At2g37310 [Vitis vinifera] Length = 667 Score = 56.6 bits (135), Expect = 9e-07 Identities = 28/48 (58%), Positives = 36/48 (75%), Gaps = 1/48 (2%) Frame = +1 Query: 1 IEAHGRLQRFIAKDASNERTEEIHALLEG-IARMRDEGYDLMDEFDEE 141 IE G L+ FIA+D S+ER+EEI+ +LEG + MR+EGY L DE DEE Sbjct: 616 IETSGGLRSFIARDVSSERSEEIYGMLEGLLGLMREEGYTLQDELDEE 663 >GAU38027.1 hypothetical protein TSUD_395870 [Trifolium subterraneum] Length = 668 Score = 55.5 bits (132), Expect = 2e-06 Identities = 28/48 (58%), Positives = 37/48 (77%), Gaps = 1/48 (2%) Frame = +1 Query: 1 IEAHGRLQRFIAKDASNERTEEIHALLEG-IARMRDEGYDLMDEFDEE 141 IE +GRL+ FIAKD SNE ++EI+ALL+G + MR+EGY L +E D E Sbjct: 620 IETNGRLREFIAKDMSNEMSDEIYALLDGLLGLMREEGYILQEELDFE 667 >XP_015949274.1 PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At2g37310 [Arachis duranensis] Length = 620 Score = 55.1 bits (131), Expect = 3e-06 Identities = 30/48 (62%), Positives = 34/48 (70%), Gaps = 1/48 (2%) Frame = +1 Query: 1 IEAHGRLQRFIAKDASNERTEEIHALLEG-IARMRDEGYDLMDEFDEE 141 IE L FIAKD SNER++EI+ALLEG + MRDEGY L DE D E Sbjct: 566 IETSRGLISFIAKDVSNERSDEIYALLEGLLGLMRDEGYALRDELDSE 613 >XP_004305232.1 PREDICTED: pentatricopeptide repeat-containing protein At2g37310 [Fragaria vesca subsp. vesca] Length = 664 Score = 54.7 bits (130), Expect = 4e-06 Identities = 28/50 (56%), Positives = 37/50 (74%), Gaps = 1/50 (2%) Frame = +1 Query: 1 IEAHGRLQRFIAKDASNERTEEIHALLEG-IARMRDEGYDLMDEFDEESV 147 IE L FIA+DASNERTE I+ +LEG + M+++GY L++E DEESV Sbjct: 612 IETSDGLHSFIARDASNERTEAIYEILEGLLGLMKEKGYVLLEELDEESV 661 >XP_016183310.1 PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At2g37310 [Arachis ipaensis] Length = 459 Score = 54.3 bits (129), Expect = 5e-06 Identities = 29/49 (59%), Positives = 36/49 (73%), Gaps = 1/49 (2%) Frame = +1 Query: 1 IEAHGRLQRFIAKDASNERTEEIHALLEG-IARMRDEGYDLMDEFDEES 144 IE L FIAKD SNER++EI+ALLEG ++ MR+EGY L DE D E+ Sbjct: 408 IETSRGLISFIAKDVSNERSDEIYALLEGLLSLMREEGYALRDELDSET 456 >XP_007208103.1 hypothetical protein PRUPE_ppa001024mg [Prunus persica] Length = 931 Score = 53.9 bits (128), Expect = 8e-06 Identities = 28/49 (57%), Positives = 35/49 (71%), Gaps = 1/49 (2%) Frame = +1 Query: 1 IEAHGRLQRFIAKDASNERTEEIHALLEG-IARMRDEGYDLMDEFDEES 144 IE LQ FIAKD SN RTEEI+ +LEG + M+++GY L DE DEE+ Sbjct: 616 IETSDGLQSFIAKDVSNGRTEEIYEILEGLLGLMKEKGYVLQDELDEET 664