BLASTX nr result
ID: Panax24_contig00037978
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00037978 (563 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KZN09828.1 hypothetical protein DCAR_002484 [Daucus carota subsp... 57 2e-07 >KZN09828.1 hypothetical protein DCAR_002484 [Daucus carota subsp. sativus] Length = 88 Score = 56.6 bits (135), Expect = 2e-07 Identities = 31/79 (39%), Positives = 39/79 (49%), Gaps = 4/79 (5%) Frame = +2 Query: 134 ESYGRKGLRNSTNCNCASPPPQQQILCKYPYQPQCSHVFQVPP----VVVNSYQAAKFYG 301 E++GRK + +SP P Q LCKY YQP + V QV P ++ + FY Sbjct: 10 ENFGRKPRSGKSTTTASSPSPPSQPLCKYQYQPNQTRVCQVAPTASHAIIETAVFMDFYN 69 Query: 302 GGGGALTNDYPLEKPFSMA 358 G A DY L KP SMA Sbjct: 70 GRAEAPNKDYFLRKPISMA 88