BLASTX nr result
ID: Panax24_contig00037951
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00037951 (520 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAU19283.1 hypothetical protein TSUD_335690 [Trifolium subterran... 72 1e-11 >GAU19283.1 hypothetical protein TSUD_335690 [Trifolium subterraneum] Length = 358 Score = 72.0 bits (175), Expect = 1e-11 Identities = 36/60 (60%), Positives = 41/60 (68%) Frame = -2 Query: 402 CCSPDTIERVHNSPKMIVRGEQELGIGCGRNSG**LRGSVNSHPFVGVQTPMSEQKKEQR 223 CCSPDTI R HNSP I+RGEQELGIGCGRN LR SV+S P G P+ +K +R Sbjct: 290 CCSPDTIVRGHNSPNTIIRGEQELGIGCGRNYRQWLRCSVDSLPLCGGPDPLRVSRKGRR 349