BLASTX nr result
ID: Panax24_contig00037920
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00037920 (693 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017234887.1 PREDICTED: pentatricopeptide repeat-containing pr... 57 9e-06 >XP_017234887.1 PREDICTED: pentatricopeptide repeat-containing protein At5g16420, mitochondrial-like isoform X1 [Daucus carota subsp. sativus] XP_017234888.1 PREDICTED: pentatricopeptide repeat-containing protein At5g16420, mitochondrial-like isoform X1 [Daucus carota subsp. sativus] XP_017234889.1 PREDICTED: pentatricopeptide repeat-containing protein At5g16420, mitochondrial-like isoform X1 [Daucus carota subsp. sativus] Length = 555 Score = 56.6 bits (135), Expect = 9e-06 Identities = 29/57 (50%), Positives = 33/57 (57%) Frame = +1 Query: 1 SILVEGLYDSGQEXXXXXXXXXXXXXXQGIDTDTWRVFIAKSFPELDHGEATINRLL 171 SILVEGLYDSGQE QGIDTDTW + I++ F LD I+RLL Sbjct: 486 SILVEGLYDSGQEAEVPQILALAASSVQGIDTDTWEIIISRLFANLDQKSDVIDRLL 542