BLASTX nr result
ID: Panax24_contig00037780
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00037780 (426 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_019161096.1 PREDICTED: protein SCO1 homolog 1, mitochondrial ... 82 6e-16 XP_006366947.1 PREDICTED: protein SCO1 homolog 1, mitochondrial ... 82 1e-15 XP_013648116.1 PREDICTED: protein SCO1 homolog 1, mitochondrial-... 79 2e-15 XP_013648111.1 PREDICTED: protein SCO1 homolog 1, mitochondrial ... 79 2e-15 XP_013648110.1 PREDICTED: protein SCO1 homolog 1, mitochondrial ... 79 2e-15 XP_013648109.1 PREDICTED: protein SCO1 homolog 1, mitochondrial ... 79 2e-15 XP_010255751.1 PREDICTED: protein SCO1 homolog 1, mitochondrial ... 81 2e-15 KFK38282.1 hypothetical protein AALP_AA3G094000 [Arabis alpina] 80 4e-15 CDY07895.1 BnaC03g36280D [Brassica napus] 79 4e-15 XP_017244438.1 PREDICTED: protein SCO1 homolog 1, mitochondrial ... 80 6e-15 AAF07830.1 putative SCO1 protein [Arabidopsis thaliana] 79 6e-15 XP_009135077.1 PREDICTED: protein SCO1 homolog 1, mitochondrial-... 79 9e-15 XP_013736084.1 PREDICTED: protein SCO1 homolog 1, mitochondrial-... 79 9e-15 XP_015086488.1 PREDICTED: protein SCO1 homolog 1, mitochondrial ... 79 1e-14 XP_004246749.1 PREDICTED: protein SCO1 homolog 1, mitochondrial ... 79 1e-14 XP_009146968.1 PREDICTED: protein SCO1 homolog 1, mitochondrial ... 79 1e-14 CDY44669.1 BnaA05g29370D [Brassica napus] 79 1e-14 XP_013583997.1 PREDICTED: protein SCO1 homolog 1, mitochondrial ... 79 1e-14 XP_002882593.1 electron transport SCO1/SenC family protein [Arab... 79 1e-14 NP_566339.1 electron transport SCO1/SenC family protein [Arabido... 79 1e-14 >XP_019161096.1 PREDICTED: protein SCO1 homolog 1, mitochondrial [Ipomoea nil] Length = 335 Score = 82.4 bits (202), Expect = 6e-16 Identities = 36/44 (81%), Positives = 44/44 (100%) Frame = -1 Query: 426 LVDHSIIMYLMDPSMQFVKFYGKNHNVDTLTDGIIKEIKQYKKV 295 LVDHSI+MYLMDP+M+FVKF+GKN++VD+LTDG+IKEIKQYKKV Sbjct: 290 LVDHSIVMYLMDPNMEFVKFFGKNNDVDSLTDGVIKEIKQYKKV 333 >XP_006366947.1 PREDICTED: protein SCO1 homolog 1, mitochondrial [Solanum tuberosum] Length = 336 Score = 81.6 bits (200), Expect = 1e-15 Identities = 37/44 (84%), Positives = 42/44 (95%) Frame = -1 Query: 426 LVDHSIIMYLMDPSMQFVKFYGKNHNVDTLTDGIIKEIKQYKKV 295 LVDHSI+MYLMDP M+FVKF+GKN++VD LTDGIIKEIKQYKKV Sbjct: 291 LVDHSIVMYLMDPKMEFVKFFGKNNDVDMLTDGIIKEIKQYKKV 334 >XP_013648116.1 PREDICTED: protein SCO1 homolog 1, mitochondrial-like isoform X2 [Brassica napus] Length = 206 Score = 79.0 bits (193), Expect = 2e-15 Identities = 33/43 (76%), Positives = 40/43 (93%) Frame = -1 Query: 426 LVDHSIIMYLMDPSMQFVKFYGKNHNVDTLTDGIIKEIKQYKK 298 LVDHSI+MYLM P M FVKFYGKNH+VD+LTDG++KEI+QY+K Sbjct: 164 LVDHSIVMYLMSPEMSFVKFYGKNHDVDSLTDGVVKEIRQYRK 206 >XP_013648111.1 PREDICTED: protein SCO1 homolog 1, mitochondrial isoform X3 [Brassica napus] Length = 206 Score = 79.0 bits (193), Expect = 2e-15 Identities = 33/43 (76%), Positives = 40/43 (93%) Frame = -1 Query: 426 LVDHSIIMYLMDPSMQFVKFYGKNHNVDTLTDGIIKEIKQYKK 298 LVDHSI+MYLM P M FVKFYGKNH+VD+LTDG++KEI+QY+K Sbjct: 164 LVDHSIVMYLMSPEMNFVKFYGKNHDVDSLTDGVVKEIRQYRK 206 >XP_013648110.1 PREDICTED: protein SCO1 homolog 1, mitochondrial isoform X2 [Brassica napus] XP_013648115.1 PREDICTED: protein SCO1 homolog 1, mitochondrial-like isoform X1 [Brassica napus] Length = 207 Score = 79.0 bits (193), Expect = 2e-15 Identities = 33/43 (76%), Positives = 40/43 (93%) Frame = -1 Query: 426 LVDHSIIMYLMDPSMQFVKFYGKNHNVDTLTDGIIKEIKQYKK 298 LVDHSI+MYLM P M FVKFYGKNH+VD+LTDG++KEI+QY+K Sbjct: 165 LVDHSIVMYLMSPEMSFVKFYGKNHDVDSLTDGVVKEIRQYRK 207 >XP_013648109.1 PREDICTED: protein SCO1 homolog 1, mitochondrial isoform X1 [Brassica napus] Length = 207 Score = 79.0 bits (193), Expect = 2e-15 Identities = 33/43 (76%), Positives = 40/43 (93%) Frame = -1 Query: 426 LVDHSIIMYLMDPSMQFVKFYGKNHNVDTLTDGIIKEIKQYKK 298 LVDHSI+MYLM P M FVKFYGKNH+VD+LTDG++KEI+QY+K Sbjct: 165 LVDHSIVMYLMSPEMNFVKFYGKNHDVDSLTDGVVKEIRQYRK 207 >XP_010255751.1 PREDICTED: protein SCO1 homolog 1, mitochondrial [Nelumbo nucifera] Length = 394 Score = 81.3 bits (199), Expect = 2e-15 Identities = 37/44 (84%), Positives = 41/44 (93%) Frame = -1 Query: 426 LVDHSIIMYLMDPSMQFVKFYGKNHNVDTLTDGIIKEIKQYKKV 295 LVDHSIIMYLM P M+FVKF+GKNH+VDTLT G+IKEIKQYKKV Sbjct: 351 LVDHSIIMYLMGPDMEFVKFFGKNHDVDTLTGGVIKEIKQYKKV 394 >KFK38282.1 hypothetical protein AALP_AA3G094000 [Arabis alpina] Length = 328 Score = 80.1 bits (196), Expect = 4e-15 Identities = 34/43 (79%), Positives = 40/43 (93%) Frame = -1 Query: 426 LVDHSIIMYLMDPSMQFVKFYGKNHNVDTLTDGIIKEIKQYKK 298 LVDHSI+MYLM P M FVKFYGKNH+VD+LTDG++KEI+QYKK Sbjct: 286 LVDHSIVMYLMSPEMNFVKFYGKNHDVDSLTDGVVKEIRQYKK 328 >CDY07895.1 BnaC03g36280D [Brassica napus] Length = 246 Score = 79.0 bits (193), Expect = 4e-15 Identities = 33/43 (76%), Positives = 40/43 (93%) Frame = -1 Query: 426 LVDHSIIMYLMDPSMQFVKFYGKNHNVDTLTDGIIKEIKQYKK 298 LVDHSI+MYLM P M FVKFYGKNH+VD+LTDG++KEI+QY+K Sbjct: 204 LVDHSIVMYLMSPEMSFVKFYGKNHDVDSLTDGVVKEIRQYRK 246 >XP_017244438.1 PREDICTED: protein SCO1 homolog 1, mitochondrial [Daucus carota subsp. sativus] KZM97240.1 hypothetical protein DCAR_015398 [Daucus carota subsp. sativus] Length = 329 Score = 79.7 bits (195), Expect = 6e-15 Identities = 36/43 (83%), Positives = 41/43 (95%) Frame = -1 Query: 426 LVDHSIIMYLMDPSMQFVKFYGKNHNVDTLTDGIIKEIKQYKK 298 LVDHSIIMYLMDP+MQFVKFYGKNH+VD+LTDG+I+EI QY K Sbjct: 283 LVDHSIIMYLMDPNMQFVKFYGKNHDVDSLTDGVIQEIHQYIK 325 >AAF07830.1 putative SCO1 protein [Arabidopsis thaliana] Length = 273 Score = 79.0 bits (193), Expect = 6e-15 Identities = 33/43 (76%), Positives = 40/43 (93%) Frame = -1 Query: 426 LVDHSIIMYLMDPSMQFVKFYGKNHNVDTLTDGIIKEIKQYKK 298 LVDHSI+MYLM P M FVKFYGKNH+VD+LTDG++KEI+QY+K Sbjct: 231 LVDHSIVMYLMSPEMNFVKFYGKNHDVDSLTDGVVKEIRQYRK 273 >XP_009135077.1 PREDICTED: protein SCO1 homolog 1, mitochondrial-like [Brassica rapa] Length = 316 Score = 79.0 bits (193), Expect = 9e-15 Identities = 33/43 (76%), Positives = 40/43 (93%) Frame = -1 Query: 426 LVDHSIIMYLMDPSMQFVKFYGKNHNVDTLTDGIIKEIKQYKK 298 LVDHSI+MYLM P M FVKFYGKNH+VD+LTDG++KEI+QY+K Sbjct: 274 LVDHSIVMYLMSPEMSFVKFYGKNHDVDSLTDGVVKEIRQYRK 316 >XP_013736084.1 PREDICTED: protein SCO1 homolog 1, mitochondrial-like [Brassica napus] CDX73949.1 BnaA03g30980D [Brassica napus] Length = 316 Score = 79.0 bits (193), Expect = 9e-15 Identities = 33/43 (76%), Positives = 40/43 (93%) Frame = -1 Query: 426 LVDHSIIMYLMDPSMQFVKFYGKNHNVDTLTDGIIKEIKQYKK 298 LVDHSI+MYLM P M FVKFYGKNH+VD+LTDG++KEI+QY+K Sbjct: 274 LVDHSIVMYLMSPEMSFVKFYGKNHDVDSLTDGVVKEIRQYRK 316 >XP_015086488.1 PREDICTED: protein SCO1 homolog 1, mitochondrial [Solanum pennellii] Length = 325 Score = 79.0 bits (193), Expect = 1e-14 Identities = 36/44 (81%), Positives = 41/44 (93%) Frame = -1 Query: 426 LVDHSIIMYLMDPSMQFVKFYGKNHNVDTLTDGIIKEIKQYKKV 295 LVDHSI+MYLMDP M+FVKF+GKN++V LTDGIIKEIKQYKKV Sbjct: 280 LVDHSIVMYLMDPKMEFVKFFGKNNDVGMLTDGIIKEIKQYKKV 323 >XP_004246749.1 PREDICTED: protein SCO1 homolog 1, mitochondrial [Solanum lycopersicum] Length = 325 Score = 79.0 bits (193), Expect = 1e-14 Identities = 36/44 (81%), Positives = 41/44 (93%) Frame = -1 Query: 426 LVDHSIIMYLMDPSMQFVKFYGKNHNVDTLTDGIIKEIKQYKKV 295 LVDHSI+MYLMDP M+FVKF+GKN++V LTDGIIKEIKQYKKV Sbjct: 280 LVDHSIVMYLMDPKMEFVKFFGKNNDVGMLTDGIIKEIKQYKKV 323 >XP_009146968.1 PREDICTED: protein SCO1 homolog 1, mitochondrial [Brassica rapa] Length = 332 Score = 79.0 bits (193), Expect = 1e-14 Identities = 33/43 (76%), Positives = 40/43 (93%) Frame = -1 Query: 426 LVDHSIIMYLMDPSMQFVKFYGKNHNVDTLTDGIIKEIKQYKK 298 LVDHSI+MYLM P M FVKFYGKNH+VD+LTDG++KEI+QY+K Sbjct: 290 LVDHSIVMYLMSPEMNFVKFYGKNHDVDSLTDGVVKEIRQYRK 332 >CDY44669.1 BnaA05g29370D [Brassica napus] Length = 332 Score = 79.0 bits (193), Expect = 1e-14 Identities = 33/43 (76%), Positives = 40/43 (93%) Frame = -1 Query: 426 LVDHSIIMYLMDPSMQFVKFYGKNHNVDTLTDGIIKEIKQYKK 298 LVDHSI+MYLM P M FVKFYGKNH+VD+LTDG++KEI+QY+K Sbjct: 290 LVDHSIVMYLMSPEMNFVKFYGKNHDVDSLTDGVVKEIRQYRK 332 >XP_013583997.1 PREDICTED: protein SCO1 homolog 1, mitochondrial [Brassica oleracea var. oleracea] XP_013693356.1 PREDICTED: protein SCO1 homolog 1, mitochondrial [Brassica napus] CDY53086.1 BnaCnng24160D [Brassica napus] Length = 332 Score = 79.0 bits (193), Expect = 1e-14 Identities = 33/43 (76%), Positives = 40/43 (93%) Frame = -1 Query: 426 LVDHSIIMYLMDPSMQFVKFYGKNHNVDTLTDGIIKEIKQYKK 298 LVDHSI+MYLM P M FVKFYGKNH+VD+LTDG++KEI+QY+K Sbjct: 290 LVDHSIVMYLMSPEMNFVKFYGKNHDVDSLTDGVVKEIRQYRK 332 >XP_002882593.1 electron transport SCO1/SenC family protein [Arabidopsis lyrata subsp. lyrata] EFH58852.1 electron transport SCO1/SenC family protein [Arabidopsis lyrata subsp. lyrata] Length = 334 Score = 79.0 bits (193), Expect = 1e-14 Identities = 33/43 (76%), Positives = 40/43 (93%) Frame = -1 Query: 426 LVDHSIIMYLMDPSMQFVKFYGKNHNVDTLTDGIIKEIKQYKK 298 LVDHSI+MYLM P M FVKFYGKNH+VD+LTDG++KEI+QY+K Sbjct: 292 LVDHSIVMYLMSPEMNFVKFYGKNHDVDSLTDGVVKEIRQYRK 334 >NP_566339.1 electron transport SCO1/SenC family protein [Arabidopsis thaliana] Q8VYP0.1 RecName: Full=Protein SCO1 homolog 1, mitochondrial; AltName: Full=Homolog of the copper chaperone SCO1 member 1; Short=HCC1; Flags: Precursor AAL49889.1 putative SCO1 protein [Arabidopsis thaliana] AAM20370.1 putative SCO1 protein [Arabidopsis thaliana] AAM62491.1 putative SCO1 protein [Arabidopsis thaliana] AEE74701.1 electron transport SCO1/SenC family protein [Arabidopsis thaliana] OAP06781.1 HCC1 [Arabidopsis thaliana] Length = 334 Score = 79.0 bits (193), Expect = 1e-14 Identities = 33/43 (76%), Positives = 40/43 (93%) Frame = -1 Query: 426 LVDHSIIMYLMDPSMQFVKFYGKNHNVDTLTDGIIKEIKQYKK 298 LVDHSI+MYLM P M FVKFYGKNH+VD+LTDG++KEI+QY+K Sbjct: 292 LVDHSIVMYLMSPEMNFVKFYGKNHDVDSLTDGVVKEIRQYRK 334