BLASTX nr result
ID: Panax24_contig00037773
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00037773 (378 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value OAO89228.1 hypothetical protein AXX17_ATUG02970 (mitochondrion) ... 55 9e-08 AAW63680.1 NADH dehydrogenase subunit 7, partial (mitochondrion)... 52 1e-06 JAU34308.1 NADH dehydrogenase [ubiquinone] iron-sulfur protein 2... 52 1e-06 AAW63676.1 NADH dehydrogenase subunit 7, partial (mitochondrion)... 52 1e-06 AOF47029.1 NADH dehydrogenase subunit 7, partial (mitochondrion)... 52 1e-06 KRG88447.1 hypothetical protein GLYMA_U040900 [Glycine max] 52 2e-06 KRG88441.1 hypothetical protein GLYMA_U041400 [Glycine max] KRH1... 52 2e-06 CDY45550.1 BnaCnng13090D [Brassica napus] 52 2e-06 EEF27243.1 NADH-ubiquinone oxidoreductase fe-s protein, putative... 52 2e-06 KYP77515.1 NADH-ubiquinone oxidoreductase 49 kDa subunit [Cajanu... 52 4e-06 CBI33445.3 unnamed protein product, partial [Vitis vinifera] 52 4e-06 AOF47019.1 NADH dehydrogenase subunit 7, partial (mitochondrion)... 52 5e-06 AGC78962.1 OR96 (mitochondrion) [Vicia faba] AGC78989.1 OR96 (mi... 51 6e-06 JAU90156.1 NADH dehydrogenase [ubiquinone] iron-sulfur protein 2... 52 6e-06 >OAO89228.1 hypothetical protein AXX17_ATUG02970 (mitochondrion) [Arabidopsis thaliana] Length = 53 Score = 54.7 bits (130), Expect = 9e-08 Identities = 27/30 (90%), Positives = 27/30 (90%), Gaps = 2/30 (6%) Frame = -2 Query: 86 SYF--VGTIASITD*KDTKFSFRCFNCGIG 3 SYF VGTIASITD KDTKFSFRCFNCGIG Sbjct: 7 SYFTTVGTIASITDQKDTKFSFRCFNCGIG 36 >AAW63680.1 NADH dehydrogenase subunit 7, partial (mitochondrion) [Asarum sp. Qiu 96018] Length = 65 Score = 52.4 bits (124), Expect = 1e-06 Identities = 24/25 (96%), Positives = 24/25 (96%) Frame = +3 Query: 3 TYTAVEASKGEFGVFLVSNGSNRPY 77 TYTAVEA KGEFGVFLVSNGSNRPY Sbjct: 19 TYTAVEAPKGEFGVFLVSNGSNRPY 43 >JAU34308.1 NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, partial [Noccaea caerulescens] Length = 78 Score = 52.4 bits (124), Expect = 1e-06 Identities = 24/25 (96%), Positives = 24/25 (96%) Frame = +3 Query: 3 TYTAVEASKGEFGVFLVSNGSNRPY 77 TYTAVEA KGEFGVFLVSNGSNRPY Sbjct: 26 TYTAVEAPKGEFGVFLVSNGSNRPY 50 >AAW63676.1 NADH dehydrogenase subunit 7, partial (mitochondrion) [Laurus nobilis] Length = 80 Score = 52.4 bits (124), Expect = 1e-06 Identities = 24/25 (96%), Positives = 24/25 (96%) Frame = +3 Query: 3 TYTAVEASKGEFGVFLVSNGSNRPY 77 TYTAVEA KGEFGVFLVSNGSNRPY Sbjct: 19 TYTAVEAPKGEFGVFLVSNGSNRPY 43 >AOF47029.1 NADH dehydrogenase subunit 7, partial (mitochondrion) [Zostera marina] Length = 83 Score = 52.4 bits (124), Expect = 1e-06 Identities = 24/25 (96%), Positives = 24/25 (96%) Frame = +3 Query: 3 TYTAVEASKGEFGVFLVSNGSNRPY 77 TYTAVEA KGEFGVFLVSNGSNRPY Sbjct: 16 TYTAVEAPKGEFGVFLVSNGSNRPY 40 >KRG88447.1 hypothetical protein GLYMA_U040900 [Glycine max] Length = 96 Score = 52.4 bits (124), Expect = 2e-06 Identities = 24/25 (96%), Positives = 24/25 (96%) Frame = +3 Query: 3 TYTAVEASKGEFGVFLVSNGSNRPY 77 TYTAVEA KGEFGVFLVSNGSNRPY Sbjct: 29 TYTAVEAPKGEFGVFLVSNGSNRPY 53 >KRG88441.1 hypothetical protein GLYMA_U041400 [Glycine max] KRH12698.1 hypothetical protein GLYMA_15G188000 [Glycine max] Length = 96 Score = 52.4 bits (124), Expect = 2e-06 Identities = 24/25 (96%), Positives = 24/25 (96%) Frame = +3 Query: 3 TYTAVEASKGEFGVFLVSNGSNRPY 77 TYTAVEA KGEFGVFLVSNGSNRPY Sbjct: 29 TYTAVEAPKGEFGVFLVSNGSNRPY 53 >CDY45550.1 BnaCnng13090D [Brassica napus] Length = 96 Score = 52.4 bits (124), Expect = 2e-06 Identities = 24/25 (96%), Positives = 24/25 (96%) Frame = +3 Query: 3 TYTAVEASKGEFGVFLVSNGSNRPY 77 TYTAVEA KGEFGVFLVSNGSNRPY Sbjct: 29 TYTAVEAPKGEFGVFLVSNGSNRPY 53 >EEF27243.1 NADH-ubiquinone oxidoreductase fe-s protein, putative [Ricinus communis] Length = 96 Score = 52.4 bits (124), Expect = 2e-06 Identities = 24/25 (96%), Positives = 24/25 (96%) Frame = +3 Query: 3 TYTAVEASKGEFGVFLVSNGSNRPY 77 TYTAVEA KGEFGVFLVSNGSNRPY Sbjct: 29 TYTAVEAPKGEFGVFLVSNGSNRPY 53 >KYP77515.1 NADH-ubiquinone oxidoreductase 49 kDa subunit [Cajanus cajan] Length = 127 Score = 52.4 bits (124), Expect = 4e-06 Identities = 24/25 (96%), Positives = 24/25 (96%) Frame = +3 Query: 3 TYTAVEASKGEFGVFLVSNGSNRPY 77 TYTAVEA KGEFGVFLVSNGSNRPY Sbjct: 60 TYTAVEAPKGEFGVFLVSNGSNRPY 84 >CBI33445.3 unnamed protein product, partial [Vitis vinifera] Length = 130 Score = 52.4 bits (124), Expect = 4e-06 Identities = 24/25 (96%), Positives = 24/25 (96%) Frame = +3 Query: 3 TYTAVEASKGEFGVFLVSNGSNRPY 77 TYTAVEA KGEFGVFLVSNGSNRPY Sbjct: 63 TYTAVEAPKGEFGVFLVSNGSNRPY 87 >AOF47019.1 NADH dehydrogenase subunit 7, partial (mitochondrion) [Maundia triglochinoides] Length = 141 Score = 52.4 bits (124), Expect = 5e-06 Identities = 24/25 (96%), Positives = 24/25 (96%) Frame = +3 Query: 3 TYTAVEASKGEFGVFLVSNGSNRPY 77 TYTAVEA KGEFGVFLVSNGSNRPY Sbjct: 74 TYTAVEAPKGEFGVFLVSNGSNRPY 98 >AGC78962.1 OR96 (mitochondrion) [Vicia faba] AGC78989.1 OR96 (mitochondrion) [Vicia faba] Length = 96 Score = 51.2 bits (121), Expect = 6e-06 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = +3 Query: 3 TYTAVEASKGEFGVFLVSNGSNRPY 77 TYT+VEA KGEFGVFLVSNGSNRPY Sbjct: 29 TYTSVEAPKGEFGVFLVSNGSNRPY 53 >JAU90156.1 NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, partial [Noccaea caerulescens] Length = 149 Score = 52.4 bits (124), Expect = 6e-06 Identities = 24/25 (96%), Positives = 24/25 (96%) Frame = +3 Query: 3 TYTAVEASKGEFGVFLVSNGSNRPY 77 TYTAVEA KGEFGVFLVSNGSNRPY Sbjct: 97 TYTAVEAPKGEFGVFLVSNGSNRPY 121