BLASTX nr result
ID: Panax24_contig00037521
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00037521 (418 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_015898385.1 PREDICTED: putative white-brown complex homolog p... 57 9e-07 XP_017234677.1 PREDICTED: ABC transporter G family member 28 iso... 56 2e-06 XP_017234676.1 PREDICTED: ABC transporter G family member 28 iso... 56 2e-06 KZN05239.1 hypothetical protein DCAR_006076 [Daucus carota subsp... 56 2e-06 >XP_015898385.1 PREDICTED: putative white-brown complex homolog protein 30 [Ziziphus jujuba] Length = 1085 Score = 57.0 bits (136), Expect = 9e-07 Identities = 30/46 (65%), Positives = 35/46 (76%), Gaps = 6/46 (13%) Frame = -1 Query: 349 GEF----KANIELRQDHADNNFLKSFD--KRVTPGVLRQYRYFLGR 230 GEF K N+E+++DH D+NFLKS D R TPGVLRQYRYFLGR Sbjct: 799 GEFWQDVKYNVEMKKDHMDHNFLKSPDLSNRRTPGVLRQYRYFLGR 844 >XP_017234677.1 PREDICTED: ABC transporter G family member 28 isoform X2 [Daucus carota subsp. sativus] Length = 989 Score = 55.8 bits (133), Expect = 2e-06 Identities = 25/41 (60%), Positives = 31/41 (75%), Gaps = 2/41 (4%) Frame = -1 Query: 346 EFKANIELRQDHADNNFLKSFD--KRVTPGVLRQYRYFLGR 230 + K N+E+R DH +N+LKS D R+TPGV RQYRYFLGR Sbjct: 707 DIKTNVEIRNDHIKHNYLKSSDLSNRITPGVYRQYRYFLGR 747 >XP_017234676.1 PREDICTED: ABC transporter G family member 28 isoform X1 [Daucus carota subsp. sativus] Length = 1019 Score = 55.8 bits (133), Expect = 2e-06 Identities = 25/41 (60%), Positives = 31/41 (75%), Gaps = 2/41 (4%) Frame = -1 Query: 346 EFKANIELRQDHADNNFLKSFD--KRVTPGVLRQYRYFLGR 230 + K N+E+R DH +N+LKS D R+TPGV RQYRYFLGR Sbjct: 707 DIKTNVEIRNDHIKHNYLKSSDLSNRITPGVYRQYRYFLGR 747 >KZN05239.1 hypothetical protein DCAR_006076 [Daucus carota subsp. sativus] Length = 1080 Score = 55.8 bits (133), Expect = 2e-06 Identities = 25/41 (60%), Positives = 31/41 (75%), Gaps = 2/41 (4%) Frame = -1 Query: 346 EFKANIELRQDHADNNFLKSFD--KRVTPGVLRQYRYFLGR 230 + K N+E+R DH +N+LKS D R+TPGV RQYRYFLGR Sbjct: 809 DIKTNVEIRNDHIKHNYLKSSDLSNRITPGVYRQYRYFLGR 849