BLASTX nr result
ID: Panax24_contig00037403
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00037403 (516 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CAN73781.1 hypothetical protein VITISV_004971 [Vitis vinifera] 54 2e-06 CAN75188.1 hypothetical protein VITISV_032368 [Vitis vinifera] 56 4e-06 >CAN73781.1 hypothetical protein VITISV_004971 [Vitis vinifera] Length = 116 Score = 54.3 bits (129), Expect = 2e-06 Identities = 27/55 (49%), Positives = 40/55 (72%), Gaps = 4/55 (7%) Frame = -2 Query: 470 DPIQVHVGSVTRARTKRFKE*LNGLIQKVW--TNTGSRTF--EEDSKLINIVQTI 318 DP+ V VG +T+AR+K+ KE LNGLIQ++W +NTG F +ED ++N++Q I Sbjct: 60 DPLHVLVGPITKARSKKIKEALNGLIQEIWVDSNTGHSKFGPKEDEGVMNLIQAI 114 >CAN75188.1 hypothetical protein VITISV_032368 [Vitis vinifera] Length = 771 Score = 56.2 bits (134), Expect = 4e-06 Identities = 28/55 (50%), Positives = 40/55 (72%), Gaps = 4/55 (7%) Frame = -2 Query: 470 DPIQVHVGSVTRARTKRFKE*LNGLIQKVW--TNTGSRTF--EEDSKLINIVQTI 318 DP+ V VG +T+AR+K+ KE LNGLIQ++W +NTG F +ED +IN++Q I Sbjct: 715 DPLHVXVGPITKARSKKIKESLNGLIQEIWADSNTGHSKFGPKEDEGVINLIQAI 769