BLASTX nr result
ID: Panax24_contig00037257
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00037257 (363 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017241259.1 PREDICTED: pentatricopeptide repeat-containing pr... 79 1e-14 OAY60485.1 hypothetical protein MANES_01G116200 [Manihot esculenta] 67 1e-10 CBI33534.3 unnamed protein product, partial [Vitis vinifera] 64 2e-09 XP_010693912.1 PREDICTED: pentatricopeptide repeat-containing pr... 63 3e-09 XP_002272930.1 PREDICTED: pentatricopeptide repeat-containing pr... 63 4e-09 KNA22345.1 hypothetical protein SOVF_035000 [Spinacia oleracea] 59 1e-07 XP_012077781.1 PREDICTED: pentatricopeptide repeat-containing pr... 59 1e-07 XP_010274756.1 PREDICTED: pentatricopeptide repeat-containing pr... 58 2e-07 XP_006383312.1 hypothetical protein POPTR_0005s14380g, partial [... 58 2e-07 XP_010274683.1 PREDICTED: pentatricopeptide repeat-containing pr... 58 2e-07 XP_007215347.1 hypothetical protein PRUPE_ppa005397mg [Prunus pe... 58 2e-07 ONI17450.1 hypothetical protein PRUPE_3G160100 [Prunus persica] 58 3e-07 XP_011021408.1 PREDICTED: pentatricopeptide repeat-containing pr... 57 4e-07 XP_011021407.1 PREDICTED: pentatricopeptide repeat-containing pr... 57 5e-07 GAV73135.1 PPR domain-containing protein/PPR_2 domain-containing... 56 9e-07 XP_008229242.2 PREDICTED: pentatricopeptide repeat-containing pr... 56 9e-07 XP_009371795.1 PREDICTED: pentatricopeptide repeat-containing pr... 56 9e-07 XP_012854441.1 PREDICTED: pentatricopeptide repeat-containing pr... 56 1e-06 XP_018816985.1 PREDICTED: pentatricopeptide repeat-containing pr... 55 2e-06 XP_018816984.1 PREDICTED: pentatricopeptide repeat-containing pr... 55 2e-06 >XP_017241259.1 PREDICTED: pentatricopeptide repeat-containing protein At1g77360, mitochondrial-like [Daucus carota subsp. sativus] KZN01986.1 hypothetical protein DCAR_010740 [Daucus carota subsp. sativus] Length = 503 Score = 78.6 bits (192), Expect = 1e-14 Identities = 40/62 (64%), Positives = 50/62 (80%), Gaps = 5/62 (8%) Frame = +3 Query: 192 TSKINPKKRNLSS-----DSASHRDQVGKRPTFVSYNDTPNLPPKVKLLCEIIANTPSVS 356 +S+++ KKR+ S+ DS + + +VGKRPTF SY DTPNLPPKVKLLCEIIANTPS+S Sbjct: 15 SSRLDYKKRHRSASLVHNDSPAGKHKVGKRPTFASYLDTPNLPPKVKLLCEIIANTPSLS 74 Query: 357 IE 362 IE Sbjct: 75 IE 76 >OAY60485.1 hypothetical protein MANES_01G116200 [Manihot esculenta] Length = 508 Score = 67.4 bits (163), Expect = 1e-10 Identities = 33/53 (62%), Positives = 38/53 (71%) Frame = +3 Query: 204 NPKKRNLSSDSASHRDQVGKRPTFVSYNDTPNLPPKVKLLCEIIANTPSVSIE 362 +P +S+ S + KRPTF SY DTPNLPPKVKLLCEIIANTPS S+E Sbjct: 26 SPSSSTTTSNLQSSSNPQTKRPTFPSYLDTPNLPPKVKLLCEIIANTPSSSVE 78 >CBI33534.3 unnamed protein product, partial [Vitis vinifera] Length = 506 Score = 63.5 bits (153), Expect = 2e-09 Identities = 33/55 (60%), Positives = 43/55 (78%), Gaps = 2/55 (3%) Frame = +3 Query: 204 NPKKRNLSS--DSASHRDQVGKRPTFVSYNDTPNLPPKVKLLCEIIANTPSVSIE 362 +P +R+ SS DSA+H Q KRP+F +Y +TPNL PKV+LLCEIIANTPS ++E Sbjct: 26 SPARRHSSSTTDSATHH-QTPKRPSFPTYLETPNLSPKVRLLCEIIANTPSSTVE 79 >XP_010693912.1 PREDICTED: pentatricopeptide repeat-containing protein At1g77360, mitochondrial [Beta vulgaris subsp. vulgaris] KMT18652.1 hypothetical protein BVRB_2g027810 [Beta vulgaris subsp. vulgaris] Length = 504 Score = 63.2 bits (152), Expect = 3e-09 Identities = 26/36 (72%), Positives = 33/36 (91%) Frame = +3 Query: 255 VGKRPTFVSYNDTPNLPPKVKLLCEIIANTPSVSIE 362 +GKRP FVSY ++PNLPPK+KL+CEI+ANTPS S+E Sbjct: 42 LGKRPNFVSYLESPNLPPKIKLICEIVANTPSSSVE 77 >XP_002272930.1 PREDICTED: pentatricopeptide repeat-containing protein At1g77360, mitochondrial [Vitis vinifera] XP_010660324.1 PREDICTED: pentatricopeptide repeat-containing protein At1g77360, mitochondrial [Vitis vinifera] XP_019080870.1 PREDICTED: pentatricopeptide repeat-containing protein At1g77360, mitochondrial [Vitis vinifera] Length = 502 Score = 62.8 bits (151), Expect = 4e-09 Identities = 30/53 (56%), Positives = 41/53 (77%) Frame = +3 Query: 204 NPKKRNLSSDSASHRDQVGKRPTFVSYNDTPNLPPKVKLLCEIIANTPSVSIE 362 N + + ++DSA+H Q KRP+F +Y +TPNL PKV+LLCEIIANTPS ++E Sbjct: 24 NKRHSSSTTDSATHH-QTPKRPSFPTYLETPNLSPKVRLLCEIIANTPSSTVE 75 >KNA22345.1 hypothetical protein SOVF_035000 [Spinacia oleracea] Length = 505 Score = 58.5 bits (140), Expect = 1e-07 Identities = 26/38 (68%), Positives = 33/38 (86%), Gaps = 2/38 (5%) Frame = +3 Query: 255 VGK--RPTFVSYNDTPNLPPKVKLLCEIIANTPSVSIE 362 VGK RP F+SY D+PNLP K+KL+CEI+ANTPS+S+E Sbjct: 41 VGKQQRPNFISYLDSPNLPSKIKLICEIVANTPSLSVE 78 >XP_012077781.1 PREDICTED: pentatricopeptide repeat-containing protein At1g77360, mitochondrial-like [Jatropha curcas] KDP33157.1 hypothetical protein JCGZ_13422 [Jatropha curcas] Length = 510 Score = 58.5 bits (140), Expect = 1e-07 Identities = 31/58 (53%), Positives = 37/58 (63%), Gaps = 7/58 (12%) Frame = +3 Query: 210 KKRNLSSDSASHRDQVG-------KRPTFVSYNDTPNLPPKVKLLCEIIANTPSVSIE 362 KK + S S+S R KRP F SY DTPNLP K+KLLCE+IANTPS ++E Sbjct: 26 KKHHFRSPSSSSRATAEHQSSYSPKRPNFPSYIDTPNLPSKIKLLCELIANTPSSAVE 83 >XP_010274756.1 PREDICTED: pentatricopeptide repeat-containing protein At1g77360, mitochondrial-like [Nelumbo nucifera] Length = 320 Score = 58.2 bits (139), Expect = 2e-07 Identities = 31/68 (45%), Positives = 40/68 (58%), Gaps = 11/68 (16%) Frame = +3 Query: 192 TSKINPKKRNLSSDSASHRDQVG-----------KRPTFVSYNDTPNLPPKVKLLCEIIA 338 +SK K+ SS A+ G +RP F+SY ++PNLPPK KLLCEIIA Sbjct: 14 SSKPEQNKKRQSSSYANPASDEGPEQQKQNQRQSRRPAFISYLESPNLPPKTKLLCEIIA 73 Query: 339 NTPSVSIE 362 NTPS ++E Sbjct: 74 NTPSPTVE 81 >XP_006383312.1 hypothetical protein POPTR_0005s14380g, partial [Populus trichocarpa] ERP61109.1 hypothetical protein POPTR_0005s14380g, partial [Populus trichocarpa] Length = 497 Score = 58.2 bits (139), Expect = 2e-07 Identities = 29/51 (56%), Positives = 38/51 (74%) Frame = +3 Query: 210 KKRNLSSDSASHRDQVGKRPTFVSYNDTPNLPPKVKLLCEIIANTPSVSIE 362 K R+ S S+S + K+P+F SY +TPNLPP +KLLCEIIANTPS ++E Sbjct: 21 KHRHHHSPSSS---SITKKPSFQSYLETPNLPPTIKLLCEIIANTPSHNVE 68 >XP_010274683.1 PREDICTED: pentatricopeptide repeat-containing protein At1g77360, mitochondrial-like [Nelumbo nucifera] Length = 508 Score = 58.2 bits (139), Expect = 2e-07 Identities = 31/68 (45%), Positives = 40/68 (58%), Gaps = 11/68 (16%) Frame = +3 Query: 192 TSKINPKKRNLSSDSASHRDQVG-----------KRPTFVSYNDTPNLPPKVKLLCEIIA 338 +SK K+ SS A+ G +RP F+SY ++PNLPPK KLLCEIIA Sbjct: 14 SSKPEQNKKRQSSSYANPASDEGPEQQKQNQRQSRRPAFISYLESPNLPPKTKLLCEIIA 73 Query: 339 NTPSVSIE 362 NTPS ++E Sbjct: 74 NTPSPTVE 81 >XP_007215347.1 hypothetical protein PRUPE_ppa005397mg [Prunus persica] Length = 463 Score = 57.8 bits (138), Expect = 2e-07 Identities = 24/34 (70%), Positives = 30/34 (88%) Frame = +3 Query: 261 KRPTFVSYNDTPNLPPKVKLLCEIIANTPSVSIE 362 KRPTF SY DTPNLPPK++LLCEI+A T ++S+E Sbjct: 3 KRPTFASYLDTPNLPPKIRLLCEIVAKTHTLSVE 36 >ONI17450.1 hypothetical protein PRUPE_3G160100 [Prunus persica] Length = 535 Score = 57.8 bits (138), Expect = 3e-07 Identities = 24/34 (70%), Positives = 30/34 (88%) Frame = +3 Query: 261 KRPTFVSYNDTPNLPPKVKLLCEIIANTPSVSIE 362 KRPTF SY DTPNLPPK++LLCEI+A T ++S+E Sbjct: 75 KRPTFASYLDTPNLPPKIRLLCEIVAKTHTLSVE 108 >XP_011021408.1 PREDICTED: pentatricopeptide repeat-containing protein At1g52640, mitochondrial-like isoform X2 [Populus euphratica] Length = 399 Score = 57.0 bits (136), Expect = 4e-07 Identities = 29/65 (44%), Positives = 39/65 (60%), Gaps = 12/65 (18%) Frame = +3 Query: 204 NPKKRNLSSD------------SASHRDQVGKRPTFVSYNDTPNLPPKVKLLCEIIANTP 347 N KKR L SD + + ++P+F SY +TPNLPP +K+LCEIIANTP Sbjct: 4 NSKKRPLDSDLNQNLIRKHHHHHSPSSSSITRKPSFPSYLETPNLPPTIKILCEIIANTP 63 Query: 348 SVSIE 362 S ++E Sbjct: 64 SHNVE 68 >XP_011021407.1 PREDICTED: pentatricopeptide repeat-containing protein At1g77360, mitochondrial-like isoform X1 [Populus euphratica] Length = 499 Score = 57.0 bits (136), Expect = 5e-07 Identities = 29/65 (44%), Positives = 39/65 (60%), Gaps = 12/65 (18%) Frame = +3 Query: 204 NPKKRNLSSD------------SASHRDQVGKRPTFVSYNDTPNLPPKVKLLCEIIANTP 347 N KKR L SD + + ++P+F SY +TPNLPP +K+LCEIIANTP Sbjct: 4 NSKKRPLDSDLNQNLIRKHHHHHSPSSSSITRKPSFPSYLETPNLPPTIKILCEIIANTP 63 Query: 348 SVSIE 362 S ++E Sbjct: 64 SHNVE 68 >GAV73135.1 PPR domain-containing protein/PPR_2 domain-containing protein [Cephalotus follicularis] Length = 501 Score = 56.2 bits (134), Expect = 9e-07 Identities = 26/34 (76%), Positives = 29/34 (85%) Frame = +3 Query: 261 KRPTFVSYNDTPNLPPKVKLLCEIIANTPSVSIE 362 KRP F SY DTP+L PKVKLLCEIIA TPS++IE Sbjct: 41 KRPVFSSYKDTPDLAPKVKLLCEIIAATPSLTIE 74 >XP_008229242.2 PREDICTED: pentatricopeptide repeat-containing protein At1g77360, mitochondrial-like [Prunus mume] Length = 514 Score = 56.2 bits (134), Expect = 9e-07 Identities = 24/31 (77%), Positives = 27/31 (87%) Frame = +3 Query: 261 KRPTFVSYNDTPNLPPKVKLLCEIIANTPSV 353 KRPTF SY DTPNLPPK++LLCEI+ANT V Sbjct: 75 KRPTFASYLDTPNLPPKIRLLCEIVANTHKV 105 >XP_009371795.1 PREDICTED: pentatricopeptide repeat-containing protein At1g77360, mitochondrial-like [Pyrus x bretschneideri] Length = 535 Score = 56.2 bits (134), Expect = 9e-07 Identities = 25/36 (69%), Positives = 29/36 (80%) Frame = +3 Query: 255 VGKRPTFVSYNDTPNLPPKVKLLCEIIANTPSVSIE 362 V KRPTF SY DTPNLPPK+ LLCEI+A T + S+E Sbjct: 73 VAKRPTFASYLDTPNLPPKIGLLCEILAKTHTPSVE 108 >XP_012854441.1 PREDICTED: pentatricopeptide repeat-containing protein At1g77360, mitochondrial-like [Erythranthe guttata] XP_012854448.1 PREDICTED: pentatricopeptide repeat-containing protein At1g77360, mitochondrial-like [Erythranthe guttata] EYU44576.1 hypothetical protein MIMGU_mgv1a004507mg [Erythranthe guttata] Length = 523 Score = 55.8 bits (133), Expect = 1e-06 Identities = 26/55 (47%), Positives = 38/55 (69%) Frame = +3 Query: 198 KINPKKRNLSSDSASHRDQVGKRPTFVSYNDTPNLPPKVKLLCEIIANTPSVSIE 362 +I+P N ++ HR GKR F+SY + P+LPPKVK+LC+IIA TP+ ++E Sbjct: 44 RISPPS-NFPDQNSRHR-VTGKRSNFISYTELPSLPPKVKILCQIIAETPAAAVE 96 >XP_018816985.1 PREDICTED: pentatricopeptide repeat-containing protein At1g77360, mitochondrial-like isoform X5 [Juglans regia] Length = 521 Score = 55.5 bits (132), Expect = 2e-06 Identities = 26/45 (57%), Positives = 30/45 (66%) Frame = +3 Query: 228 SDSASHRDQVGKRPTFVSYNDTPNLPPKVKLLCEIIANTPSVSIE 362 S +H RP F SY+D P+L PKVKL CEIIA TPSVS+E Sbjct: 46 SPPQTHLPNKRSRPAFASYSDAPDLHPKVKLFCEIIATTPSVSVE 90 >XP_018816984.1 PREDICTED: pentatricopeptide repeat-containing protein At1g77360, mitochondrial-like isoform X4 [Juglans regia] Length = 530 Score = 55.5 bits (132), Expect = 2e-06 Identities = 26/45 (57%), Positives = 30/45 (66%) Frame = +3 Query: 228 SDSASHRDQVGKRPTFVSYNDTPNLPPKVKLLCEIIANTPSVSIE 362 S +H RP F SY+D P+L PKVKL CEIIA TPSVS+E Sbjct: 46 SPPQTHLPNKRSRPAFASYSDAPDLHPKVKLFCEIIATTPSVSVE 90