BLASTX nr result
ID: Panax24_contig00037080
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00037080 (376 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_011095527.1 PREDICTED: mitochondrial import inner membrane tr... 64 1e-09 XP_019196552.1 PREDICTED: mitochondrial import inner membrane tr... 64 1e-09 KNA11700.1 hypothetical protein SOVF_132710 [Spinacia oleracea] 64 2e-09 ABF70066.1 mitochondrial inner membrane preprotein translocase (... 60 3e-09 KZV48155.1 hypothetical protein F511_27718 [Dorcoceras hygrometr... 60 3e-09 ONK67428.1 uncharacterized protein A4U43_C06F20150 [Asparagus of... 60 4e-09 XP_016498633.1 PREDICTED: mitochondrial import inner membrane tr... 60 7e-09 XP_016544810.1 PREDICTED: mitochondrial import inner membrane tr... 61 2e-08 EOY12055.1 Haloacid dehalogenase-like hydrolase (HAD) superfamil... 61 2e-08 XP_016581415.1 PREDICTED: mitochondrial import inner membrane tr... 61 2e-08 XP_010672507.1 PREDICTED: mitochondrial import inner membrane tr... 61 2e-08 XP_009602717.1 PREDICTED: mitochondrial import inner membrane tr... 61 2e-08 XP_019251075.1 PREDICTED: mitochondrial import inner membrane tr... 61 2e-08 XP_009764636.1 PREDICTED: mitochondrial import inner membrane tr... 61 2e-08 XP_002264515.1 PREDICTED: mitochondrial import inner membrane tr... 61 2e-08 XP_015056479.1 PREDICTED: mitochondrial import inner membrane tr... 60 3e-08 XP_004248309.1 PREDICTED: mitochondrial import inner membrane tr... 60 3e-08 XP_018686780.1 PREDICTED: mitochondrial import inner membrane tr... 60 4e-08 XP_009419065.1 PREDICTED: mitochondrial import inner membrane tr... 60 4e-08 XP_008345016.1 PREDICTED: mitochondrial import inner membrane tr... 60 4e-08 >XP_011095527.1 PREDICTED: mitochondrial import inner membrane translocase subunit TIM50 [Sesamum indicum] Length = 354 Score = 64.3 bits (155), Expect = 1e-09 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +3 Query: 3 GRDIAKEFIERSKEHQKRMQEQKQQGRFWRR 95 GRDIAKEF+ERSKEHQ+RMQEQKQQGR WRR Sbjct: 324 GRDIAKEFVERSKEHQRRMQEQKQQGRLWRR 354 >XP_019196552.1 PREDICTED: mitochondrial import inner membrane translocase subunit TIM50 [Ipomoea nil] Length = 359 Score = 64.3 bits (155), Expect = 1e-09 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +3 Query: 3 GRDIAKEFIERSKEHQKRMQEQKQQGRFWRR 95 GRD+AKEFIERSKEHQ+RMQEQKQQGR WRR Sbjct: 329 GRDVAKEFIERSKEHQRRMQEQKQQGRIWRR 359 >KNA11700.1 hypothetical protein SOVF_132710 [Spinacia oleracea] Length = 362 Score = 63.5 bits (153), Expect = 2e-09 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +3 Query: 3 GRDIAKEFIERSKEHQKRMQEQKQQGRFWRR 95 GRDI KEFIERSKEH++RMQEQKQQGRFWRR Sbjct: 332 GRDIPKEFIERSKEHKRRMQEQKQQGRFWRR 362 >ABF70066.1 mitochondrial inner membrane preprotein translocase (TIM23) component-related [Musa acuminata] Length = 109 Score = 60.1 bits (144), Expect = 3e-09 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = +3 Query: 3 GRDIAKEFIERSKEHQKRMQEQKQQGRFWRR 95 G DIA EFIERSKEHQ+RMQ+QKQ GRFWRR Sbjct: 79 GHDIASEFIERSKEHQRRMQDQKQHGRFWRR 109 >KZV48155.1 hypothetical protein F511_27718 [Dorcoceras hygrometricum] Length = 98 Score = 59.7 bits (143), Expect = 3e-09 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = +3 Query: 3 GRDIAKEFIERSKEHQKRMQEQKQQGRFWRR 95 GRDIAKE +ERSKEHQ+RMQEQKQ RFWRR Sbjct: 68 GRDIAKELLERSKEHQRRMQEQKQHSRFWRR 98 >ONK67428.1 uncharacterized protein A4U43_C06F20150 [Asparagus officinalis] Length = 105 Score = 59.7 bits (143), Expect = 4e-09 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = +3 Query: 3 GRDIAKEFIERSKEHQKRMQEQKQQGRFWRR 95 G DIA+EFIERSKEHQKRMQEQ Q GRFW+R Sbjct: 75 GHDIAREFIERSKEHQKRMQEQNQHGRFWQR 105 >XP_016498633.1 PREDICTED: mitochondrial import inner membrane translocase subunit TIM50-like, partial [Nicotiana tabacum] Length = 134 Score = 59.7 bits (143), Expect = 7e-09 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = +3 Query: 3 GRDIAKEFIERSKEHQKRMQEQKQQGRFWRR 95 GRDI KEFIERSK++Q+RMQEQKQ GRFWRR Sbjct: 104 GRDIPKEFIERSKDYQRRMQEQKQHGRFWRR 134 >XP_016544810.1 PREDICTED: mitochondrial import inner membrane translocase subunit TIM50-like [Capsicum annuum] Length = 357 Score = 61.2 bits (147), Expect = 2e-08 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = +3 Query: 3 GRDIAKEFIERSKEHQKRMQEQKQQGRFWRR 95 GRDIAKEFIERSKEHQ+R+QEQKQ GR WRR Sbjct: 327 GRDIAKEFIERSKEHQRRVQEQKQHGRLWRR 357 >EOY12055.1 Haloacid dehalogenase-like hydrolase (HAD) superfamily protein, putative isoform 2 [Theobroma cacao] Length = 390 Score = 61.2 bits (147), Expect = 2e-08 Identities = 26/37 (70%), Positives = 32/37 (86%) Frame = +3 Query: 6 RDIAKEFIERSKEHQKRMQEQKQQGRFWRR*DQRKWN 116 +DIAKEF+ERSK++Q+RMQEQ+QQGRFWRR WN Sbjct: 338 KDIAKEFLERSKDYQRRMQEQRQQGRFWRRFVMLSWN 374 >XP_016581415.1 PREDICTED: mitochondrial import inner membrane translocase subunit TIM50 [Capsicum annuum] Length = 348 Score = 60.8 bits (146), Expect = 2e-08 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = +3 Query: 3 GRDIAKEFIERSKEHQKRMQEQKQQGRFWRR 95 G DIAKEFIERSKEHQ+RMQEQKQ RFWRR Sbjct: 317 GHDIAKEFIERSKEHQRRMQEQKQHSRFWRR 347 >XP_010672507.1 PREDICTED: mitochondrial import inner membrane translocase subunit TIM50 [Beta vulgaris subsp. vulgaris] KMT15572.1 hypothetical protein BVRB_3g059220 [Beta vulgaris subsp. vulgaris] Length = 354 Score = 60.8 bits (146), Expect = 2e-08 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = +3 Query: 3 GRDIAKEFIERSKEHQKRMQEQKQQGRFWRR 95 GRDI KEFIERSKEHQ+RMQE KQ GRFWRR Sbjct: 324 GRDIPKEFIERSKEHQRRMQETKQHGRFWRR 354 >XP_009602717.1 PREDICTED: mitochondrial import inner membrane translocase subunit TIM50-like [Nicotiana tomentosiformis] XP_016505580.1 PREDICTED: mitochondrial import inner membrane translocase subunit TIM50-like [Nicotiana tabacum] Length = 356 Score = 60.8 bits (146), Expect = 2e-08 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = +3 Query: 3 GRDIAKEFIERSKEHQKRMQEQKQQGRFWRR 95 GRDIAKEFIERSKEH +RMQEQKQ GR WRR Sbjct: 326 GRDIAKEFIERSKEHNRRMQEQKQHGRIWRR 356 >XP_019251075.1 PREDICTED: mitochondrial import inner membrane translocase subunit TIM50-like [Nicotiana attenuata] OIT08482.1 mitochondrial import inner membrane translocase subunit tim50 [Nicotiana attenuata] Length = 357 Score = 60.8 bits (146), Expect = 2e-08 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = +3 Query: 3 GRDIAKEFIERSKEHQKRMQEQKQQGRFWRR 95 GRDIAKEFIERSKEH +RMQEQKQ GR WRR Sbjct: 327 GRDIAKEFIERSKEHHRRMQEQKQHGRLWRR 357 >XP_009764636.1 PREDICTED: mitochondrial import inner membrane translocase subunit TIM50-like [Nicotiana sylvestris] XP_016500059.1 PREDICTED: mitochondrial import inner membrane translocase subunit TIM50-like [Nicotiana tabacum] Length = 366 Score = 60.8 bits (146), Expect = 2e-08 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = +3 Query: 3 GRDIAKEFIERSKEHQKRMQEQKQQGRFWRR 95 GRDIAKEFIERSKEH +RMQEQKQ GR WRR Sbjct: 336 GRDIAKEFIERSKEHHRRMQEQKQHGRLWRR 366 >XP_002264515.1 PREDICTED: mitochondrial import inner membrane translocase subunit TIM50 [Vitis vinifera] CBI39719.3 unnamed protein product, partial [Vitis vinifera] Length = 371 Score = 60.8 bits (146), Expect = 2e-08 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = +3 Query: 3 GRDIAKEFIERSKEHQKRMQEQKQQGRFWRR 95 G DIAKEFIERSKE+Q+RMQEQKQ GRFWRR Sbjct: 341 GHDIAKEFIERSKEYQRRMQEQKQHGRFWRR 371 >XP_015056479.1 PREDICTED: mitochondrial import inner membrane translocase subunit TIM50-like [Solanum pennellii] Length = 359 Score = 60.5 bits (145), Expect = 3e-08 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = +3 Query: 3 GRDIAKEFIERSKEHQKRMQEQKQQGRFWRR 95 GRDI KEF+ERSKEHQ+RMQEQKQ GR WRR Sbjct: 329 GRDIPKEFVERSKEHQRRMQEQKQHGRLWRR 359 >XP_004248309.1 PREDICTED: mitochondrial import inner membrane translocase subunit TIM50 [Solanum lycopersicum] Length = 359 Score = 60.5 bits (145), Expect = 3e-08 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = +3 Query: 3 GRDIAKEFIERSKEHQKRMQEQKQQGRFWRR 95 GRDI KEF+ERSKEHQ+RMQEQKQ GR WRR Sbjct: 329 GRDIPKEFVERSKEHQRRMQEQKQHGRLWRR 359 >XP_018686780.1 PREDICTED: mitochondrial import inner membrane translocase subunit TIM50-like isoform X2 [Musa acuminata subsp. malaccensis] Length = 315 Score = 60.1 bits (144), Expect = 4e-08 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = +3 Query: 3 GRDIAKEFIERSKEHQKRMQEQKQQGRFWRR 95 G DIA EFIERSKEHQ+RMQ+QKQ GRFWRR Sbjct: 285 GHDIASEFIERSKEHQRRMQDQKQHGRFWRR 315 >XP_009419065.1 PREDICTED: mitochondrial import inner membrane translocase subunit TIM50-like isoform X1 [Musa acuminata subsp. malaccensis] Length = 357 Score = 60.1 bits (144), Expect = 4e-08 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = +3 Query: 3 GRDIAKEFIERSKEHQKRMQEQKQQGRFWRR 95 G DIA EFIERSKEHQ+RMQ+QKQ GRFWRR Sbjct: 327 GHDIASEFIERSKEHQRRMQDQKQHGRFWRR 357 >XP_008345016.1 PREDICTED: mitochondrial import inner membrane translocase subunit TIM50-like [Malus domestica] Length = 363 Score = 60.1 bits (144), Expect = 4e-08 Identities = 27/31 (87%), Positives = 27/31 (87%) Frame = +3 Query: 3 GRDIAKEFIERSKEHQKRMQEQKQQGRFWRR 95 GRDI EFI RSKEHQKRMQE KQQGRFWRR Sbjct: 333 GRDIPAEFIRRSKEHQKRMQESKQQGRFWRR 363