BLASTX nr result
ID: Panax24_contig00036910
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00036910 (418 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAU26731.1 hypothetical protein TSUD_317290 [Trifolium subterran... 65 9e-10 XP_013468260.1 zinc finger (CCCH-type) family protein [Medicago ... 65 1e-09 XP_006367267.1 PREDICTED: zinc finger CCCH domain-containing pro... 65 1e-09 XP_015088589.1 PREDICTED: zinc finger CCCH domain-containing pro... 65 2e-09 XP_004246704.1 PREDICTED: zinc finger CCCH domain-containing pro... 65 2e-09 XP_006486491.1 PREDICTED: zinc finger CCCH domain-containing pro... 64 3e-09 XP_007157380.1 hypothetical protein PHAVU_002G065400g [Phaseolus... 64 3e-09 XP_006436191.1 hypothetical protein CICLE_v10031903mg [Citrus cl... 64 3e-09 XP_016469096.1 PREDICTED: zinc finger CCCH domain-containing pro... 64 3e-09 XP_009602548.1 PREDICTED: zinc finger CCCH domain-containing pro... 64 3e-09 XP_019251595.1 PREDICTED: zinc finger CCCH domain-containing pro... 64 3e-09 XP_009788679.1 PREDICTED: zinc finger CCCH domain-containing pro... 64 3e-09 XP_009602547.1 PREDICTED: zinc finger CCCH domain-containing pro... 64 3e-09 XP_009788678.1 PREDICTED: zinc finger CCCH domain-containing pro... 64 3e-09 KVI06915.1 hypothetical protein Ccrd_014728 [Cynara cardunculus ... 64 4e-09 KVI04958.1 Zinc finger, CCCH-type [Cynara cardunculus var. scoly... 64 4e-09 XP_016542466.1 PREDICTED: zinc finger CCCH domain-containing pro... 63 5e-09 XP_004307428.1 PREDICTED: zinc finger CCCH domain-containing pro... 63 7e-09 XP_006828300.1 PREDICTED: zinc finger CCCH domain-containing pro... 62 1e-08 XP_002312050.1 hypothetical protein POPTR_0008s04540g [Populus t... 62 1e-08 >GAU26731.1 hypothetical protein TSUD_317290 [Trifolium subterraneum] Length = 306 Score = 65.1 bits (157), Expect = 9e-10 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 326 MPPKQSKADVAKKQKVVEDKTFGLKNKNKSK 418 MPPKQSKADVAKKQKVVEDKTFGLKNKNKSK Sbjct: 1 MPPKQSKADVAKKQKVVEDKTFGLKNKNKSK 31 >XP_013468260.1 zinc finger (CCCH-type) family protein [Medicago truncatula] KEH42297.1 zinc finger (CCCH-type) family protein [Medicago truncatula] Length = 361 Score = 65.1 bits (157), Expect = 1e-09 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 326 MPPKQSKADVAKKQKVVEDKTFGLKNKNKSK 418 MPPKQSKADVAKKQKVVEDKTFGLKNKNKSK Sbjct: 1 MPPKQSKADVAKKQKVVEDKTFGLKNKNKSK 31 >XP_006367267.1 PREDICTED: zinc finger CCCH domain-containing protein 11 [Solanum tuberosum] Length = 374 Score = 65.1 bits (157), Expect = 1e-09 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 326 MPPKQSKADVAKKQKVVEDKTFGLKNKNKSK 418 MPPKQSKADVAKKQKVVEDKTFGLKNKNKSK Sbjct: 1 MPPKQSKADVAKKQKVVEDKTFGLKNKNKSK 31 >XP_015088589.1 PREDICTED: zinc finger CCCH domain-containing protein 11 [Solanum pennellii] Length = 374 Score = 64.7 bits (156), Expect = 2e-09 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = +2 Query: 326 MPPKQSKADVAKKQKVVEDKTFGLKNKNKSK 418 MPPKQSKAD+AKKQKVVEDKTFGLKNKNKSK Sbjct: 1 MPPKQSKADIAKKQKVVEDKTFGLKNKNKSK 31 >XP_004246704.1 PREDICTED: zinc finger CCCH domain-containing protein 11 [Solanum lycopersicum] Length = 374 Score = 64.7 bits (156), Expect = 2e-09 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = +2 Query: 326 MPPKQSKADVAKKQKVVEDKTFGLKNKNKSK 418 MPPKQSKAD+AKKQKVVEDKTFGLKNKNKSK Sbjct: 1 MPPKQSKADIAKKQKVVEDKTFGLKNKNKSK 31 >XP_006486491.1 PREDICTED: zinc finger CCCH domain-containing protein 11-like [Citrus sinensis] Length = 338 Score = 63.9 bits (154), Expect = 3e-09 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = +2 Query: 326 MPPKQSKADVAKKQKVVEDKTFGLKNKNKSK 418 MPPKQSKAD+AKKQKVVEDKTFGLKNKNKSK Sbjct: 1 MPPKQSKADLAKKQKVVEDKTFGLKNKNKSK 31 >XP_007157380.1 hypothetical protein PHAVU_002G065400g [Phaseolus vulgaris] ESW29374.1 hypothetical protein PHAVU_002G065400g [Phaseolus vulgaris] Length = 359 Score = 63.9 bits (154), Expect = 3e-09 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = +2 Query: 326 MPPKQSKADVAKKQKVVEDKTFGLKNKNKSK 418 MPPKQSKAD+AKKQKVVEDKTFGLKNKNKSK Sbjct: 1 MPPKQSKADLAKKQKVVEDKTFGLKNKNKSK 31 >XP_006436191.1 hypothetical protein CICLE_v10031903mg [Citrus clementina] ESR49431.1 hypothetical protein CICLE_v10031903mg [Citrus clementina] KDO67886.1 hypothetical protein CISIN_1g017965mg [Citrus sinensis] Length = 363 Score = 63.9 bits (154), Expect = 3e-09 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = +2 Query: 326 MPPKQSKADVAKKQKVVEDKTFGLKNKNKSK 418 MPPKQSKAD+AKKQKVVEDKTFGLKNKNKSK Sbjct: 1 MPPKQSKADLAKKQKVVEDKTFGLKNKNKSK 31 >XP_016469096.1 PREDICTED: zinc finger CCCH domain-containing protein 11-like [Nicotiana tabacum] Length = 376 Score = 63.9 bits (154), Expect = 3e-09 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = +2 Query: 326 MPPKQSKADVAKKQKVVEDKTFGLKNKNKSK 418 MPPKQSKAD+AKKQKVVEDKTFGLKNKNKSK Sbjct: 1 MPPKQSKADLAKKQKVVEDKTFGLKNKNKSK 31 >XP_009602548.1 PREDICTED: zinc finger CCCH domain-containing protein 11 isoform X2 [Nicotiana tomentosiformis] Length = 376 Score = 63.9 bits (154), Expect = 3e-09 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = +2 Query: 326 MPPKQSKADVAKKQKVVEDKTFGLKNKNKSK 418 MPPKQSKAD+AKKQKVVEDKTFGLKNKNKSK Sbjct: 1 MPPKQSKADLAKKQKVVEDKTFGLKNKNKSK 31 >XP_019251595.1 PREDICTED: zinc finger CCCH domain-containing protein 11 [Nicotiana attenuata] OIT08563.1 zinc finger ccch domain-containing protein 11 [Nicotiana attenuata] Length = 377 Score = 63.9 bits (154), Expect = 3e-09 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = +2 Query: 326 MPPKQSKADVAKKQKVVEDKTFGLKNKNKSK 418 MPPKQSKAD+AKKQKVVEDKTFGLKNKNKSK Sbjct: 1 MPPKQSKADLAKKQKVVEDKTFGLKNKNKSK 31 >XP_009788679.1 PREDICTED: zinc finger CCCH domain-containing protein 11-like isoform X2 [Nicotiana sylvestris] XP_016463307.1 PREDICTED: zinc finger CCCH domain-containing protein 11-like isoform X2 [Nicotiana tabacum] Length = 377 Score = 63.9 bits (154), Expect = 3e-09 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = +2 Query: 326 MPPKQSKADVAKKQKVVEDKTFGLKNKNKSK 418 MPPKQSKAD+AKKQKVVEDKTFGLKNKNKSK Sbjct: 1 MPPKQSKADLAKKQKVVEDKTFGLKNKNKSK 31 >XP_009602547.1 PREDICTED: zinc finger CCCH domain-containing protein 11 isoform X1 [Nicotiana tomentosiformis] Length = 382 Score = 63.9 bits (154), Expect = 3e-09 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = +2 Query: 326 MPPKQSKADVAKKQKVVEDKTFGLKNKNKSK 418 MPPKQSKAD+AKKQKVVEDKTFGLKNKNKSK Sbjct: 1 MPPKQSKADLAKKQKVVEDKTFGLKNKNKSK 31 >XP_009788678.1 PREDICTED: zinc finger CCCH domain-containing protein 11-like isoform X1 [Nicotiana sylvestris] XP_016463306.1 PREDICTED: zinc finger CCCH domain-containing protein 11-like isoform X1 [Nicotiana tabacum] Length = 383 Score = 63.9 bits (154), Expect = 3e-09 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = +2 Query: 326 MPPKQSKADVAKKQKVVEDKTFGLKNKNKSK 418 MPPKQSKAD+AKKQKVVEDKTFGLKNKNKSK Sbjct: 1 MPPKQSKADLAKKQKVVEDKTFGLKNKNKSK 31 >KVI06915.1 hypothetical protein Ccrd_014728 [Cynara cardunculus var. scolymus] Length = 347 Score = 63.5 bits (153), Expect = 4e-09 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = +2 Query: 326 MPPKQSKADVAKKQKVVEDKTFGLKNKNKSK 418 MPPKQSKAD+AKKQK+VEDKTFGLKNKNKSK Sbjct: 1 MPPKQSKADLAKKQKIVEDKTFGLKNKNKSK 31 >KVI04958.1 Zinc finger, CCCH-type [Cynara cardunculus var. scolymus] Length = 402 Score = 63.5 bits (153), Expect = 4e-09 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = +2 Query: 326 MPPKQSKADVAKKQKVVEDKTFGLKNKNKSK 418 MPPKQSKA+VAKKQKVVEDKTFGLKNKNKSK Sbjct: 1 MPPKQSKAEVAKKQKVVEDKTFGLKNKNKSK 31 >XP_016542466.1 PREDICTED: zinc finger CCCH domain-containing protein 11 [Capsicum annuum] Length = 372 Score = 63.2 bits (152), Expect = 5e-09 Identities = 28/31 (90%), Positives = 31/31 (100%) Frame = +2 Query: 326 MPPKQSKADVAKKQKVVEDKTFGLKNKNKSK 418 MPPKQSK+D+AKKQK+VEDKTFGLKNKNKSK Sbjct: 1 MPPKQSKSDIAKKQKIVEDKTFGLKNKNKSK 31 >XP_004307428.1 PREDICTED: zinc finger CCCH domain-containing protein 11-like [Fragaria vesca subsp. vesca] Length = 363 Score = 62.8 bits (151), Expect = 7e-09 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +2 Query: 326 MPPKQSKADVAKKQKVVEDKTFGLKNKNKSK 418 MPPK SKADVAKKQKVVEDKTFGLKNKNKSK Sbjct: 1 MPPKASKADVAKKQKVVEDKTFGLKNKNKSK 31 >XP_006828300.1 PREDICTED: zinc finger CCCH domain-containing protein 11 [Amborella trichopoda] ERM95716.1 hypothetical protein AMTR_s00023p00231760 [Amborella trichopoda] Length = 360 Score = 62.4 bits (150), Expect = 1e-08 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = +2 Query: 326 MPPKQSKADVAKKQKVVEDKTFGLKNKNKSK 418 MPPKQSKA++AKKQKVVEDKTFGLKNKNKSK Sbjct: 1 MPPKQSKAELAKKQKVVEDKTFGLKNKNKSK 31 >XP_002312050.1 hypothetical protein POPTR_0008s04540g [Populus trichocarpa] EEE89417.1 hypothetical protein POPTR_0008s04540g [Populus trichocarpa] Length = 363 Score = 62.0 bits (149), Expect = 1e-08 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = +2 Query: 326 MPPKQSKADVAKKQKVVEDKTFGLKNKNKSK 418 MPPKQSKAD+AKKQKVVEDKTFGLKNK+KSK Sbjct: 1 MPPKQSKADLAKKQKVVEDKTFGLKNKSKSK 31