BLASTX nr result
ID: Panax24_contig00036770
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00036770 (653 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_003615432.1 hypothetical protein MTR_5g067940 [Medicago trunc... 98 2e-23 XP_003605622.1 hypothetical protein MTR_4g035030 [Medicago trunc... 79 8e-16 KJB23821.1 hypothetical protein B456_004G116300 [Gossypium raimo... 57 6e-08 >XP_003615432.1 hypothetical protein MTR_5g067940 [Medicago truncatula] AES98390.1 hypothetical protein MTR_5g067940 [Medicago truncatula] Length = 69 Score = 98.2 bits (243), Expect = 2e-23 Identities = 55/70 (78%), Positives = 57/70 (81%), Gaps = 3/70 (4%) Frame = +3 Query: 9 MAELVDATDLIGLSLGMETY*VITFKFRETPELIKMGNPEPNPVFRKQ---TKVQKAKKG 179 MAELVDATDLIGLSLGMETY V TFKFRET EL KMGNPEPNP FRKQ + + KK Sbjct: 1 MAELVDATDLIGLSLGMETYQVKTFKFRETLEL-KMGNPEPNPSFRKQINKSLESENKKR 59 Query: 180 IGAETQWKLF 209 IGAETQWKLF Sbjct: 60 IGAETQWKLF 69 >XP_003605622.1 hypothetical protein MTR_4g035030 [Medicago truncatula] AES87819.1 hypothetical protein MTR_4g035030 [Medicago truncatula] Length = 95 Score = 79.3 bits (194), Expect = 8e-16 Identities = 42/48 (87%), Positives = 43/48 (89%) Frame = +3 Query: 9 MAELVDATDLIGLSLGMETY*VITFKFRETPELIKMGNPEPNPVFRKQ 152 MA+LVDATDLIGLSLGMETY V TFKFRET EL KMGNPEPNP FRKQ Sbjct: 1 MAKLVDATDLIGLSLGMETYQVKTFKFRETLEL-KMGNPEPNPSFRKQ 47 >KJB23821.1 hypothetical protein B456_004G116300 [Gossypium raimondii] Length = 34 Score = 57.0 bits (136), Expect = 6e-08 Identities = 26/30 (86%), Positives = 27/30 (90%) Frame = +2 Query: 35 LNWIEPWYGNLLSDNFQIQRNPGINKNGQS 124 LNWIE WYGNL SDNFQIQRNPG+ KNGQS Sbjct: 6 LNWIESWYGNLRSDNFQIQRNPGM-KNGQS 34